Polypeptide MELO3C000924P1
Accession: MELO3C000924P1
Name: MELO3C000924P1
Description: Similar to NAD(P)H-quinone oxidoreductase subunit K, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q4VZH1|NDHK_CUCSA)
Sequence:
>MELO3C000924P1 Similar to NAD(P)H-quinone oxidoreductase subunit K, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q4VZH1|NDHK_CUCSA) TIKKNIETVMNSIEFPLLDRTTQTSVISTTSNDLSNWSRLSSLWPLLYGTSCCFIEFASLIGSRFDFDRYGLVPRSSPRQ ADLILTAGGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEA
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: iron-sulfur cluster binding, metal ion binding, oxidoreductase activity, acting on NADH or NADPH.
cellular_component: membrane, thylakoid, chloroplast.
biological_process: metabolic process.
These properties come from reactome analysis
REACTOME_REACTION: NADH enters the respiratory chain at Complex I (REACT_98202), NADH enters the respiratory chain at Complex I (REACT_6310).
REACTOME_PATHWAY: Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_6305), Respiratory electron transport (REACT_22393), Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_101166), Respiratory electron transport (REACT_30834).
REACTOME_COMPLEX: HP subcomplex [mitochondrial inner membrane] (REACT_6454), Complex I - 20 kDa subunit-4Fe-4S cluster complex [mitochondrial inner membrane] (REACT_6486), Complex I - NADH:Ubiquinone oxidoreductase [mitochondrial inner membrane] (REACT_6533).
biological_process: respiratory electron transport chain.
These properties come from phylome analysis
molecular_function: 4 iron, 4 sulfur cluster binding, quinone binding, NADH dehydrogenase (ubiquinone) activity, protein binding, iron ion binding, metal ion binding.
cellular_component: respiratory chain, mitochondrial respiratory chain complex I, mitochondrion.
biological_process: oxidation-reduction process, hermaphrodite genitalia development, positive regulation of multicellular organism growth, growth, mitochondrial respiratory chain complex I assembly, electron transport chain, photosynthesis, light reaction, body morphogenesis, embryo development ending in birth or egg hatching, transport, mitochondrial electron transport, NADH to ubiquinone, nematode larval development.
These properties come from kegg analysis
KEGG_ORTHOLOGS: NAD(P)H-quinone oxidoreductase subunit K [EC:1.6.5.3] (K05582).
molecular_function: NADH dehydrogenase (ubiquinone) activity.
COG: NADH:ubiquinone oxidoreductase 20 kD subunit and related Fe-S oxidoreductases (COG0377).
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MEWW_CUCME .
