Polypeptide MELO3C000965P1

Accession: MELO3C000965P1

Name: MELO3C000965P1

Description: Similar to ATP synthase subunit a (Nicotiana tabacum) (uniprot_sprot:sp|P05499|ATP6_TOBAC)

Sequence:

>MELO3C000965P1 Similar to ATP synthase subunit a (Nicotiana tabacum) (uniprot_sprot:sp|P05499|ATP6_TOBAC)
MTLTPNSPLEQFAILPLILMHIGNFYFSFTNPSLFMLLTLSLVLLLLHFATKNGGGNSVPNAWQSLVELIYEFIPNMVNE
EIGGLSGNVKQKFFPRISITLTFSLFHNPQGMIPYSFTVTSHFLITLGLSFSLFI

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_PATHWAY: Huntington's disease (ko05016), Parkinson's disease (ko05012), Alzheimer's disease (ko05010).

KEGG_ORTHOLOGS: F-type H+-transporting ATPase subunit a [EC:3.6.3.14] (K02126).

molecular_function: proton-transporting ATPase activity, rotational mechanism, hydrogen ion transporting ATP synthase activity, rotational mechanism.

KEGG_MODULE: F-type ATPase, eukaryotes (M00158).

COG: F0F1-type ATP synthase, subunit a (COG0356).

These properties come from phylome analysis


molecular_function: hydrogen ion transmembrane transporter activity.

cellular_component: proton-transporting ATP synthase complex, coupling factor F(o), integral to membrane, mitochondrial inner membrane.

biological_process: ATP synthesis coupled proton transport.

These properties come from blast2go analysis


molecular_function: hydrogen ion transmembrane transporter activity.

cellular_component: proton-transporting ATP synthase complex, coupling factor F(o), integral to membrane, mitochondrial inner membrane.

biological_process: ATP synthesis coupled proton transport.

Locations

Located in CM3.5_contig37345 from 103 to 508.

This polypeptide in other databases

In PhylomeDB is Phy003MCB6_CUCME .

Related features