Polypeptide MELO3C001225P1

Accession: MELO3C001225P1

Name: MELO3C001225P1

Description: Similar to Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (Morus indica) (uniprot_sprot:sp|Q09X08|ACCD_MORIN)

Sequence:

>MELO3C001225P1 Similar to Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (Morus indica) (uniprot_sprot:sp|Q09X08|ACCD_MORIN)
MQEGSLSLMQMAKISSALYDYQSNKKLFYVAILTSPTTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTLNKAVPEGS
QEAESLFDKGLFDLIVPRNPLKGVVSELFQLHAFVPSNQNSIK*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: transferase activity, zinc ion binding, ATP binding, acetyl-CoA carboxylase activity.

cellular_component: chloroplast stroma, acetyl-CoA carboxylase complex.

biological_process: fatty acid biosynthetic process.

These properties come from phylome analysis


molecular_function: acetyl-CoA carboxylase activity.

cellular_component: acetyl-CoA carboxylase complex.

biological_process: fatty acid biosynthetic process.

Locations

Located in CM3.5_contig39628 from 111 to 482.

This polypeptide in other databases

In PhylomeDB is Phy003LH4E_CUCME .

Related features