Polypeptide MELO3C001309P1

Accession: MELO3C001309P1

Name: MELO3C001309P1

Description: Similar to 30S ribosomal protein S18, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q4VZJ5|RR18_CUCSA)

Sequence:

>MELO3C001309P1 Similar to 30S ribosomal protein S18, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q4VZJ5|RR18_CUCSA)
MDKSKRLFLKSKRSFRRRLPPIPSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNN
EKQFERSESTARTIGLRTRNK*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: small subunit ribosomal protein S18 (K02963).

cellular_component: cytosolic small ribosomal subunit.

COG: Ribosomal protein S18 (COG0238).

These properties come from phylome analysis


molecular_function: rRNA binding, structural constituent of ribosome.

cellular_component: chloroplast, mitochondrial small ribosomal subunit, ribosome.

biological_process: translation.

These properties come from blast2go analysis


molecular_function: rRNA binding, structural constituent of ribosome.

cellular_component: chloroplast stroma, ribosome, mitochondrion.

biological_process: translation.

Locations

Located in CM3.5_contig40442 from 36 to 341.

This polypeptide in other databases

In PhylomeDB is Phy003LIK1_CUCME .

Related features