Polypeptide MELO3C001358P1
Accession: MELO3C001358P1
Name: MELO3C001358P1
Description: Similar to 30S ribosomal protein S2, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q4VZP4|RR2_CUCSA)
Sequence:
>MELO3C001358P1 Similar to 30S ribosomal protein S2, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q4VZP4|RR2_CUCSA) MTRRYWKIHLEEMMEAGVHFGHGTRKWNPRMAPYISAKRKEACDFLFDAATRGKEFLIVGTKNQAADSVARAATRTRSHY LNKKWLGG
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: structural constituent of ribosome.
cellular_component: small ribosomal subunit, chloroplast.
biological_process: translation.
This polypeptide in other databases
In PhylomeDB is Phy003MH2X_CUCME .

