Polypeptide MELO3C001364P1
Accession: MELO3C001364P1
Name: MELO3C001364P1
Description: Similar to PREDICTED: hypothetical protein (Vitis vinifera) (uniref90:UniRef90_UPI00019863A4)
Sequence:
>MELO3C001364P1 Similar to PREDICTED: hypothetical protein (Vitis vinifera) (uniref90:UniRef90_UPI00019863A4) FDHADRLFNSIRDTWISAAGKGNTSDVKELIPEFFYMPEFLENTFNLDLGEKQSGEK
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: mismatched DNA binding, zinc ion binding, ATP binding.
cellular_component: nucleus.
biological_process: trichome morphogenesis, multidimensional cell growth, vacuole organization, mismatch repair.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003LKSZ_CUCME .
