Polypeptide MELO3C001387P1
Accession: MELO3C001387P1
Name: MELO3C001387P1
Description: Similar to ATP synthase subunit c, chloroplastic (Trachelium caeruleum) (uniprot_sprot:sp|A9QC36|ATPH_TRACE)
Sequence:
>MELO3C001387P1 Similar to ATP synthase subunit c, chloroplastic (Trachelium caeruleum) (uniprot_sprot:sp|A9QC36|ATPH_TRACE) MNPLISAASVIAAGLAIGLASIGPGIGQGTAAGQAVEGITRQPEAEGKIQGTLFLSLAFMEVLTIYGLVVALAL*
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_ORTHOLOGS: F-type H+-transporting ATPase subunit c [EC:3.6.3.14] (K02110).
molecular_function: proton-transporting ATPase activity, rotational mechanism, hydrogen ion transporting ATP synthase activity, rotational mechanism.
COG: F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K (COG0636).
These properties come from phylome analysis
molecular_function: hydrogen ion transmembrane transporter activity, hydrogen ion transporting ATP synthase activity, rotational mechanism, lipid binding.
cellular_component: plastid, proton-transporting ATP synthase complex, coupling factor F(o), integral to membrane, chloroplast thylakoid membrane.
biological_process: ATP hydrolysis coupled proton transport, ATP synthesis coupled proton transport.
These properties come from blast2go analysis
molecular_function: hydrogen ion transporting ATP synthase activity, rotational mechanism, lipid binding.
cellular_component: proton-transporting ATP synthase complex, coupling factor F(o), cytoplasmic membrane-bounded vesicle, integral to membrane, chloroplast thylakoid membrane.
biological_process: ATP synthesis coupled proton transport.
This polypeptide in other databases
In PhylomeDB is Phy003LGT9_CUCME .
