Polypeptide MELO3C001392P1
Accession: MELO3C001392P1
Name: MELO3C001392P1
Description: Similar to ADP,ATP carrier protein 1, mitochondrial (Gossypium hirsutum) (uniprot_sprot:sp|O22342|ADT1_GOSHI)
Sequence:
>MELO3C001392P1 Similar to ADP,ATP carrier protein 1, mitochondrial (Gossypium hirsutum) (uniprot_sprot:sp|O22342|ADT1_GOSHI) MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTIKEEGFGSLWRGNTANVIRYFPTQ
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: binding, transporter activity.
cellular_component: integral to membrane, chloroplast, plasma membrane, vacuole, mitochondrial inner membrane, nucleolus, cell wall.
biological_process: transmembrane transport.
These properties come from phylome analysis
molecular_function: binding, transporter activity.
cellular_component: integral to membrane, mitochondrial inner membrane.
biological_process: transmembrane transport.
This polypeptide in other databases
In PhylomeDB is Phy003A7OT_CUCME .
