Polypeptide MELO3C001427P1
Accession: MELO3C001427P1
Name: MELO3C001427P1
Description: Similar to Multicopper oxidase (Cucumis melo subsp. melo) (uniref90:UniRef90_E5GCD6)
Sequence:
>MELO3C001427P1 Similar to Multicopper oxidase (Cucumis melo subsp. melo) (uniref90:UniRef90_E5GCD6) MLPLTSPFFALCAFFCFFSTLSAENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDIHCVTNDNL
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: hydrolase activity, L-ascorbate oxidase activity, copper ion binding.
cellular_component: apoplast, cytoplasmic membrane-bounded vesicle, membrane, plant-type cell wall.
biological_process: oxidation-reduction process.
This polypeptide in other databases
In PhylomeDB is Phy003LN12_CUCME .