Polypeptide MELO3C001430P1
Accession: MELO3C001430P1
Name: MELO3C001430P1
Description: Similar to Polygalacturonase (Cucumis melo subsp. melo) (uniref90:UniRef90_E5GBC3)
Sequence:
>MELO3C001430P1 Similar to Polygalacturonase (Cucumis melo subsp. melo) (uniref90:UniRef90_E5GBC3) TLQFSNSKNVVVSALTSLNSQMFHIVINGCQNVTMRGIKVLASGNSPNTDGIHGQMSSNVA
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: galacturan 1,4-alpha-galacturonidase activity, polygalacturonase activity.
biological_process: cellular cell wall organization, carbohydrate metabolic process.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003LFVQ_CUCME .
