Polypeptide MELO3C001488P1
Accession: MELO3C001488P1
Name: MELO3C001488P1
Description: Similar to ABC transporter C family member 1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9C8G9|AB1C_ARATH)
Sequence:
>MELO3C001488P1 Similar to ABC transporter C family member 1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9C8G9|AB1C_ARATH) VRENILFGSPFDSAKYEKTIDITALHLDIDLLPGGDLTEIGERGVNISGGQKQRVSLARAVYSNSD
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: ATPase activity, coupled to transmembrane movement of substances, 2-alkenal reductase activity, ATP binding.
cellular_component: integral to membrane, plasma membrane, plant-type vacuole.
biological_process: oxidation-reduction process, transmembrane transport.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MEXR_CUCME .
