Polypeptide MELO3C001556P1
Accession: MELO3C001556P1
Name: MELO3C001556P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_83.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SMM8)
Sequence:
>MELO3C001556P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_83.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SMM8) MRKLKFHEQKLLKKVNFLEWKREGGHREAQVMHRYHITGRDDYKKYSSLCRGVQKLVTMLKKMNEKDPFRSELTEKLLEK L*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: rRNA binding.
cellular_component: cytosolic small ribosomal subunit, mitochondrion.
These properties come from phylome analysis
molecular_function: snoRNA binding, protein binding, RNA binding, rRNA binding.
cellular_component: Mpp10 complex, small-subunit processome, ribonucleoprotein complex, ribosome, nucleolus, intracellular, cytosolic small ribosomal subunit, mitochondrion.
biological_process: hermaphrodite genitalia development, positive regulation of growth rate, growth, embryo development ending in birth or egg hatching, receptor-mediated endocytosis, rRNA processing, nematode larval development.
This polypeptide in other databases
In PhylomeDB is Phy003MCPB_CUCME .

