Polypeptide MELO3C001556P1

Accession: MELO3C001556P1

Name: MELO3C001556P1

Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_83.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SMM8)

Sequence:

>MELO3C001556P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_83.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SMM8)
MRKLKFHEQKLLKKVNFLEWKREGGHREAQVMHRYHITGRDDYKKYSSLCRGVQKLVTMLKKMNEKDPFRSELTEKLLEK
L*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: rRNA binding.

cellular_component: cytosolic small ribosomal subunit, mitochondrion.

These properties come from phylome analysis


molecular_function: snoRNA binding, protein binding, RNA binding, rRNA binding.

cellular_component: Mpp10 complex, small-subunit processome, ribonucleoprotein complex, ribosome, nucleolus, intracellular, cytosolic small ribosomal subunit, mitochondrion.

biological_process: hermaphrodite genitalia development, positive regulation of growth rate, growth, embryo development ending in birth or egg hatching, receptor-mediated endocytosis, rRNA processing, nematode larval development.

Locations

Located in CM3.5_contig43464 from 16 to 335.

This polypeptide in other databases

In PhylomeDB is Phy003MCPB_CUCME .

Related features