Polypeptide MELO3C001664P1
Accession: MELO3C001664P1
Name: MELO3C001664P1
Description: Similar to Photosystem I P700 chlorophyll a apoprotein A1 (Cucumis sativus) (uniprot_sprot:sp|Q2QD89|PSAA_CUCSA)
Sequence:
>MELO3C001664P1 Similar to Photosystem I P700 chlorophyll a apoprotein A1 (Cucumis sativus) (uniprot_sprot:sp|Q2QD89|PSAA_CUCSA) MSALGRPQDMFSDTAIQLQPVFAQWIQNTHTLAPSITAPGATTGTSLTWGGGDLVAVGGKVALLPIPLGTADFL
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: 4 iron, 4 sulfur cluster binding, chlorophyll binding, electron carrier activity, iron ion binding, magnesium ion binding.
cellular_component: integral to membrane, chloroplast thylakoid membrane, photosystem I.
biological_process: electron transport chain, protein-chromophore linkage, photosynthesis, transport.
This polypeptide in other databases
In PhylomeDB is Phy003LK95_CUCME .
