Polypeptide MELO3C001821P1
Accession: MELO3C001821P1
Name: MELO3C001821P1
Description: Similar to Apocytochrome f (Cucumis sativus) (uniprot_sprot:sp|Q2QD76|CYF_CUCSA)
Sequence:
>MELO3C001821P1 Similar to Apocytochrome f (Cucumis sativus) (uniprot_sprot:sp|Q2QD76|CYF_CUCSA) KYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNNVYNATAAGI
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_ORTHOLOGS: apocytochrome f (K02634).
These properties come from blast2go analysis
molecular_function: heme binding, electron carrier activity.
cellular_component: integral to thylakoid membrane, chloroplast thylakoid membrane, mitochondrion.
biological_process: electron transport chain, photosynthesis, transport.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MIZS_CUCME .
