Polypeptide MELO3C001855P1
Accession: MELO3C001855P1
Name: MELO3C001855P1
Description: Similar to Gag protease polyprotein (Fragment) (Cucumis melo subsp. melo) (uniref90:UniRef90_E5GBB7)
Sequence:
>MELO3C001855P1 Similar to Gag protease polyprotein (Fragment) (Cucumis melo subsp. melo) (uniref90:UniRef90_E5GBB7) GTWGILASVVDIREADVSLSSEPVVRDYPDVFPEELPGLPPHREVEFAIELEPGTVPISRAPYRMAPAELKELK
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: zinc ion binding, aspartic-type endopeptidase activity, RNA-directed DNA polymerase activity, RNA binding, chromatin binding, DNA binding.
cellular_component: nucleus, chromatin.
biological_process: DNA integration, proteolysis, chromatin assembly or disassembly, RNA-dependent DNA replication.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MEYF_CUCME .
