Polypeptide MELO3C001923P1

Accession: MELO3C001923P1

Name: MELO3C001923P1

Description: Similar to RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (Mus musculus) (uniprot_sprot:sp|Q9CY97|SSU72_MOUSE)

Sequence:

>MELO3C001923P1 Similar to RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (Mus musculus) (uniprot_sprot:sp|Q9CY97|SSU72_MOUSE)
MKYRYAMVCSSNQNRSMEAHSILKSKGFNVSSYGTGAHVKLPGPSLREPNVYDFGTPYKHMFDDLRRKDPELYKRNGILP
MLKRNAAVKTAPQRWQDNAADGSFDVVFTFEEKVFDMVIEDLNTRDHALMKTVLIVNLEVKDNHEEAAIGARLTFDLCQE
IERTESWEDSIDDIVITFEKQLRRKLLYSISFY*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: phosphoprotein phosphatase activity.

cellular_component: chloroplast, mitochondrion, nucleus.

biological_process: mRNA processing.

These properties come from phylome analysis


molecular_function: identical protein binding, phosphoprotein phosphatase activity.

cellular_component: mRNA cleavage and polyadenylation specificity factor complex, chloroplast, nucleus.

biological_process: termination of RNA polymerase II transcription, exosome-dependent, termination of RNA polymerase II transcription, poly(A)-coupled, snoRNA transcription, transcription initiation from RNA polymerase II promoter, rRNA processing, mRNA processing.

Locations

Located in CM3.5_scaffold00001 from 100824 to 107183.

This polypeptide in other databases

In PhylomeDB is Phy003A88T_CUCME .

Related features