Polypeptide MELO3C001998P1

Accession: MELO3C001998P1

Name: MELO3C001998P1

Description: Similar to Ribulose-phosphate 3-epimerase, chloroplastic (Spinacia oleracea) (uniprot_sprot:sp|Q43157|RPE_SPIOL)

Sequence:

>MELO3C001998P1 Similar to Ribulose-phosphate 3-epimerase, chloroplastic (Spinacia oleracea) (uniprot_sprot:sp|Q43157|RPE_SPIOL)
MAVASLCQSTMQSQVSGFVGGRTFQKPPNSQPSSLTFSRRRFRNVVKASARVDRYSKSDIIVSPSILSANFAKLGEQVKA
VELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTV
NQIKSLGAKAGVVLNPATSLSTIEYVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRLCAEKGANPWIEVDGGVGPA
NAYKVIEAGANALVAGSAVFGAKDYAEAIKGIKTSKRPEAVPV*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: protein binding, ribulose-phosphate 3-epimerase activity.

cellular_component: apoplast, chloroplast envelope, chloroplast stroma, chloroplast thylakoid membrane.

biological_process: reductive pentose-phosphate cycle, pentose-phosphate shunt.

These properties come from reactome analysis


biological_process: carbohydrate metabolic process, pentose-phosphate shunt.

REACTOME_REACTION: D-ribulose 5-phosphate <=> xylulose 5-phosphate (REACT_96012), D-ribulose 5-phosphate <=> xylulose 5-phosphate (REACT_102631), xylulose 5-phosphate <=> D-ribulose 5-phosphate (REACT_11118), D-ribulose 5-phosphate <=> xylulose 5-phosphate (REACT_109378), xylulose 5-phosphate <=> D-ribulose 5-phosphate (REACT_35802), D-ribulose 5-phosphate <=> xylulose 5-phosphate (REACT_1522), xylulose 5-phosphate <=> D-ribulose 5-phosphate (REACT_109649), xylulose 5-phosphate <=> D-ribulose 5-phosphate (REACT_100824).

REACTOME_COMPLEX: RPE dimer [cytosol] (REACT_21583).

REACTOME_PATHWAY: Pentose phosphate pathway (hexose monophosphate shunt) (REACT_31274), Pentose phosphate pathway (hexose monophosphate shunt) (REACT_93433), Pentose phosphate pathway (hexose monophosphate shunt) (REACT_1859), Metabolism of carbohydrates (REACT_107409), Pentose phosphate pathway (hexose monophosphate shunt) (REACT_90926), Metabolism of carbohydrates (REACT_474), Metabolism of carbohydrates (REACT_106046), Metabolism of carbohydrates (REACT_83329).

These properties come from phylome analysis


molecular_function: protein binding, ribulose-phosphate 3-epimerase activity.

cellular_component: stromule, thylakoid, apoplast, chloroplast envelope, chloroplast stroma, chloroplast thylakoid membrane.

biological_process: response to nematode, response to cold, carbohydrate metabolic process, reductive pentose-phosphate cycle, pentose-phosphate shunt.

These properties come from kegg analysis


KEGG_REACTION: D-Ribulose-5-phosphate (R01529).

molecular_function: ribulose-phosphate 3-epimerase activity.

COG: Pentose-5-phosphate-3-epimerase (COG0036).

KEGG_PATHWAY: Pentose phosphate pathway (ko00030).

KEGG_ORTHOLOGS: ribulose-phosphate 3-epimerase [EC:5.1.3.1] (K01783).

KEGG_MODULE: Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P (M00007), Pentose phosphate pathway (Pentose phosphate cycle) (M00004).

Locations

Located in CM3.5_scaffold00001 from 562663 to 565690.

This polypeptide in other databases

In PhylomeDB is Phy003AB76_CUCME .

Related features