Polypeptide MELO3C002017P1

Accession: MELO3C002017P1

Name: MELO3C002017P1

Description: Similar to Diacylglycerol kinase 1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q39017|DGK1_ARATH)

Sequence:

>MELO3C002017P1 Similar to Diacylglycerol kinase 1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q39017|DGK1_ARATH)
MDEDWEIGLLFPSWNSKNPTDRLFVISCFSAAVIGILTIAFTAFQWRRNINLSWMKAIARSKRNPKKTQRVPVAAHDWIL
ESVSRGKNLSCCVCLKYVSPSQTLGPMVASDSFIHRCNICGVAAHLSCSSNAQKDCKCISMIGFDHVMHQWAVRWTEITD
QPDETSFCSYCEEPCSGSFLGGSPIWCCLWCQRLVHVDCHSSMCNETGDICDLGSFRRLILSPLYVKESNRMSGGFLSSI
THGANEIASSVRASIRSQSKKSKHSRKPSVHHTGSSGNLRDMSTESTADSHLTVNGYHGTERNCNGSRTSEGRHQNGDIA
DKSISNTSLKKSSSLNHKDETHILGMNLRYEVIEMPSDSRPLLVFINKKSGARRGDSLKQRLNMLLNPVQVFELSSTQGP
ESGLYLFRKVPHFKVLVCGGDGTVGWVLNCIDKQNFVSPPPVAILPAGTGNDLARVLNWGGGLGSVERQGGLCTVLHHVE
NAAVTLLDRWKVAMVDQQGKQLKSPQFMNNYLGIGCDAKVALDIHNLREENPEKFYNQFMNKVLYAREGAKSIMDRTFAD
IPWQVRVEVDGVEVEVPEDAEGVLVANIGSYMGGVDLWHNEDETFDNFDSQSMHDKVLEVVSISGTWHLGKLQVGLSRAR
RLAQGKSIRIQLCAALPVQIDGEPWFQEVPCTLVISHHGQAFMLKRAVEEPLGHAAAIITDVLESAESNNVINASQKRVL
LQEMAKRLT*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: protein binding, diacylglycerol kinase activity.

biological_process: intracellular signal transduction, activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway.

These properties come from reactome analysis


REACTOME_REACTION: DAG kinase produces phosphatidic acid from DAG (REACT_19402), DAG kinase produces phosphatidic acid from DAG (REACT_99856), DAG kinase produces phosphatidic acid from DAG (REACT_101911), DAG kinase produces phosphatidic acid from DAG (REACT_99113).

biological_process: blood coagulation, platelet activation.

REACTOME_PATHWAY: Platelet Activation (REACT_29092), Hemostasis (REACT_34525), Signaling by GPCR (REACT_92902), Formation of Platelet plug (REACT_104262), Signaling by GPCR (REACT_14797), Hemostasis (REACT_604), Signaling by GPCR (REACT_105953), G alpha (q) signalling events (REACT_94204), Platelet Activation (REACT_109042), Effects of PIP2 hydrolysis (REACT_2202), G alpha (q) signalling events (REACT_18283), Formation of Platelet plug (REACT_84458), GPCR downstream signaling (REACT_92114), GPCR downstream signaling (REACT_89233), Signaling by GPCR (REACT_81368), GPCR downstream signaling (REACT_19184), G alpha (q) signalling events (REACT_94531), G alpha (q) signalling events (REACT_78862), Effects of PIP2 hydrolysis (REACT_77048), Platelet Activation (REACT_798), Effects of PIP2 hydrolysis (REACT_95050), Formation of Platelet plug (REACT_90565), Hemostasis (REACT_92318), GPCR downstream signaling (REACT_81307), Platelet Activation (REACT_88667), Effects of PIP2 hydrolysis (REACT_30328), Hemostasis (REACT_90805), Formation of Platelet plug (REACT_20).

These properties come from phylome analysis


molecular_function: metal ion binding, ATP binding, protein binding, diacylglycerol kinase activity.

cellular_component: integral to membrane, plasma membrane.

biological_process: platelet activation, phospholipid biosynthetic process, intracellular signal transduction, activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway.

These properties come from kegg analysis


KEGG_REACTION: ATP:1,2-diacylglycerol (R02240).

KEGG_ORTHOLOGS: diacylglycerol kinase [EC:2.7.1.107] (K00901).

molecular_function: diacylglycerol kinase activity.

COG: Diacylglycerol kinase (COG0818).

KEGG_PATHWAY: Phosphatidylinositol signaling system (ko04070), Glycerophospholipid metabolism (ko00564), Glycerolipid metabolism (ko00561).

Locations

Located in CM3.5_scaffold00001 from 674452 to 679568.

This polypeptide in other databases

In PhylomeDB is Phy0039ZAN_CUCME .

Related features