Polypeptide MELO3C002050P1

Accession: MELO3C002050P1

Name: MELO3C002050P1

Description: Similar to Agamous-like MADS-box protein AGL8 homolog (Solanum tuberosum PE=2 SV=1) (uniprot_sprot:sp|Q42429|AGL8_SOLTU)

Sequence:

>MELO3C002050P1 Similar to Agamous-like MADS-box protein AGL8 homolog (Solanum tuberosum PE=2 SV=1) (uniprot_sprot:sp|Q42429|AGL8_SOLTU)
MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCMEKILERYERYSYAERRL
VANDSQSNGNWTLEHAKLKARIEVLQKNHRHFMGEDLDSLSLKELQNIEQQLDSALKHIRARKNQLMHESITELQKKGKV
LQEHNNMLGKKIKEKEKSRAHNPLMEQQQQQDSNAIESSPLLLPQPFQSLSMSCPYTTHVPEENDSTVNHDRSDTLLPPW
MLRHHLGD*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: sequence-specific DNA binding, 2-alkenal reductase activity, sequence-specific DNA binding transcription factor activity.

cellular_component: nucleus.

biological_process: oxidation-reduction process, regulation of transcription, DNA-dependent.

These properties come from reactome analysis


REACTOME_REACTION: ERK5 activates the transcription factor MEF2 (REACT_97335).

biological_process: MyD88-independent toll-like receptor signaling pathway, MyD88-dependent toll-like receptor signaling pathway, nerve growth factor receptor signaling pathway, toll-like receptor 4 signaling pathway, stress-activated MAPK cascade, innate immune response, toll-like receptor signaling pathway, Toll signaling pathway, toll-like receptor 1 signaling pathway, toll-like receptor 2 signaling pathway, toll-like receptor 3 signaling pathway.

REACTOME_PATHWAY: ERK/MAPK targets (REACT_31414), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_79305), MyD88 cascade initiated on plasma membrane (REACT_104035), MyD88-independent cascade initiated on plasma membrane (REACT_85813), MyD88 dependent cascade initiated on endosome (REACT_29524), Toll Like Receptor TLR1:TLR2 Cascade (REACT_89891), Signalling by NGF (REACT_82686), Toll Receptor Cascades (REACT_85362), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_106858), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_30390), MyD88:Mal cascade initiated on plasma membrane (REACT_80624), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_85188), Toll Like Receptor 2 Cascade (REACT_92918), NGF signalling via TRKA from the plasma membrane (REACT_102976), Innate Immunity Signaling (REACT_108180), Toll Like Receptor 3 (TLR3) Cascade (REACT_87070), Immune System (REACT_81385), MAPK targets/ Nuclear events mediated by MAP kinases (REACT_104956), Nuclear Events (kinase and transcription factor activation) (REACT_82900), Toll Like Receptor 5 (TLR5) Cascade (REACT_82163), Activated TLR4 signalling (REACT_33197), Toll Like Receptor TLR6:TLR2 Cascade (REACT_103395), Toll Like Receptor 9 (TLR9) Cascade (REACT_103126), Toll Like Receptor 4 (TLR4) Cascade (REACT_80044), MAP kinase activation in TLR cascade (REACT_98311), Toll Like Receptor 10 (TLR10) Cascade (REACT_110819).

These properties come from phylome analysis


molecular_function: protein binding, sequence-specific DNA binding, 2-alkenal reductase activity, sequence-specific DNA binding transcription factor activity.

cellular_component: nucleus.

biological_process: cell differentiation, fruit development, maintenance of inflorescence meristem identity, positive regulation of flower development, flower development, transcription, DNA-dependent, oxidation-reduction process, regulation of transcription, DNA-dependent.

These properties come from kegg analysis


KEGG_ORTHOLOGS: MADS-box transcription factor, plant (K09264).

Locations

Located in CM3.5_scaffold00001 from 900486 to 905302.

This polypeptide in other databases

In PhylomeDB is Phy003A93Y_CUCME .

Related features