Polypeptide MELO3C002118P1
Accession: MELO3C002118P1
Name: MELO3C002118P1
Description: Similar to Eukaryotic peptide chain release factor GTP-binding subunit ERF3A (Mus musculus) (uniprot_sprot:sp|Q8R050|ERF3A_MOUSE)
Sequence:
>MELO3C002118P1 Similar to Eukaryotic peptide chain release factor GTP-binding subunit ERF3A (Mus musculus) (uniprot_sprot:sp|Q8R050|ERF3A_MOUSE) MDIEEEIRALELDPPDVNGVSNQDAKMEDVGESKNLEEDVKTEEIVKSDEMEEEDHPQQTQANHLEEQVKENTSAKEKEV SLADENEVEEDLELDRKRHLNVVFIGHVDAGKSTIGGQILFLSNQVDERTIQKYEKEAKDKSRESWYMAYIMDTNEEERV KGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGYERGGQTREHVLLAKTLGVAKL LVVVNKMDDPTVKWSKERYDEIESKMAPFLRSSGYNVKKDVQFLPISGLHGVNMKTRVDKKVCPWWDGPCFFEILDMIEG PPRNPKDPFRMPIIDKFKDMGTTVMGKVESGTVREGDSLLLMPNKIQVKVTAVMCDENKVRSAGPGENLRVRISGIEEED IMSGFVLSSIAKPIPSVSEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIIELLQQIDPKTRKPMKKKVLFVKNGA VILCRVQVNNLICIEKFSDVPQLGRFTLRTEGKTVAVGKVTDISSASN*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: GTP binding, sulfate adenylyltransferase (ATP) activity, GTPase activity, translation release factor activity, translation elongation factor activity.
biological_process: translational termination.
These properties come from reactome analysis
REACTOME_REACTION: GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_227), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_81196), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_716), Formation of UPF1:eRF3 Complex on mRNA with a Premature Termination Codon and No Exon Junction Complex (REACT_75917), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_389), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_29257), SMG1 Phosphorylates UPF1 (Enhanced by Exon Junction Complex) (REACT_75910), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_84975), UPF1 Binds an mRNP with a Termination Codon Preceding an Exon Junction Complex (REACT_75753), GTP bound eRF3:eRF1 complex binds the peptidyl-tRNA:mRNA:Ribosome complex (REACT_393), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_91109), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_104420), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_109127), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_1654), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_81882), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_1152), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_94459), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_31222), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_78279), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_107771), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_83432).
REACTOME_PATHWAY: Eukaryotic Translation Termination (REACT_32804), Eukaryotic Translation Termination (REACT_34462), Nonsense Mediated Decay Independent of the Exon Junction Complex (REACT_75768), Nonsense-Mediated Decay (REACT_75886), Metabolism of RNA (REACT_21257), Nonsense Mediated Decay Enhanced by the Exon Junction Complex (REACT_75822), Translation (REACT_77710), Gene Expression (REACT_105649), Eukaryotic Translation Termination (REACT_93205), Gene Expression (REACT_85241), Metabolism of proteins (REACT_86658), Translation (REACT_86996), Metabolism of proteins (REACT_91052), Gene Expression (REACT_71), Metabolism of mRNA (REACT_20605), Eukaryotic Translation Termination (REACT_1986), Gene Expression (REACT_98256), Eukaryotic Translation Termination (REACT_103749), Translation (REACT_81833), Gene Expression (REACT_108313), Metabolism of proteins (REACT_85873), Eukaryotic Translation Termination (REACT_94463), Translation (REACT_100851), Gene Expression (REACT_91657), Metabolism of proteins (REACT_99179), Translation (REACT_1014), Metabolism of proteins (REACT_17015), Eukaryotic Translation Termination (REACT_1034), Translation (REACT_105544), Metabolism of proteins (REACT_102155).
REACTOME_COMPLEX: Translated mRNA Complex with Premature Termination Codon Not Preceding Exon Junction [cytosol] (REACT_76767), GDP bound eRF3 [cytosol] (REACT_5718), eRF3-GTP:eRF1:peptidyl-tRNA:mRNA:80S Ribosome Complex [cytosol] (REACT_5762), eRF3-GDP:eRF1:peptidyl-tRNA:mRNA:80S Ribosome Complex [cytosol] (REACT_5231), GTP bound eRF3 [cytosol] (REACT_5311), eRF3-GDP:eRF1:tRNA:mRNA:80S Ribosome Complex [cytosol] (REACT_4485), SMG1:Phosphorylated UPF1:EJC:Translated mRNP [cytosol] (REACT_76156), eRF3-GDP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_5057), UPF1:eRF3 Complex on Translated mRNA [cytosol] (REACT_76212), Translated mRNA Complex with Premature Termination Codon Preceding Exon Junction [cytosol] (REACT_76510), SMG1:UPF1:EJC:Translated mRNP [cytosol] (REACT_76647), GTP bound eRF3 [cytosol] (REACT_5462), GDP bound eRF3 [cytosol] (REACT_3556), eRF3-GDP:eRF1:80S Ribosome:mRNA:tRNA Complex [cytosol] (REACT_4303), eRF3-GTP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_4059), Phosphorylated UPF1:SMG5:SMG7:SMG6:PP2A:Translated mRNP [cytosol] (REACT_76275).
biological_process: translation, mRNA metabolic process, RNA metabolic process, gene expression, cellular protein metabolic process, translational termination.
These properties come from phylome analysis
molecular_function: protein binding, GTP binding, sulfate adenylyltransferase (ATP) activity, GTPase activity, translation release factor activity.
cellular_component: translation release factor complex, cytosol, vacuole.
biological_process: positive regulation of multicellular organism growth, locomotion, positive regulation of growth rate, growth, embryo development ending in birth or egg hatching, receptor-mediated endocytosis, nematode larval development, nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay, reproduction.
These properties come from kegg analysis
KEGG_ORTHOLOGS: peptide chain release factor subunit 3 (K03267).
molecular_function: translation release factor activity.
This polypeptide in other databases
In PhylomeDB is Phy003LI8E_CUCME .

