Polypeptide MELO3C002150P1
Accession: MELO3C002150P1
Name: MELO3C002150P1
Description: Similar to Mitogen-activated protein kinase kinase 5 (Arabidopsis thaliana) (uniprot_sprot:sp|Q8RXG3|M2K5_ARATH)
Sequence:
>MELO3C002150P1 Similar to Mitogen-activated protein kinase kinase 5 (Arabidopsis thaliana) (uniprot_sprot:sp|Q8RXG3|M2K5_ARATH) MALVRDRRHLNLRLPDLSDCRPRFPLPLPPSSAPPAPAAPSAISSSDLEKLQVLGHGNGGTVYKVRHKRTSTTYALKVVH GDCDPTVRRQVFREMEILRRTDSPYVVQCHGIFEKPSGDVTILMEYMDLGSLDSLLKKNSTLSETTLAHVSRQVLNGLHY LHSHKIIHRDIKPSNLLVNKNMEVKIADFGVSKIMCRTLDACNSYVGTCAYMSPERFDPETYGGNYNGYAGDIWSLGLTL LELYLGHFPFLPAGQRPDWATLMCAICFGEPPKLPEDASEEFRSFVECCLQKESSKRWTAAQLLTHPFVCRESSRSSSDN R*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: RAF1 phosphorylates MEK1 (REACT_545), MEK1 phosphorylates ERK-1 (REACT_110554), Phosphorylation of human JNKs by activated MKK4/MKK7 (REACT_81103), MEK1 phosphorylates ERK-1 (REACT_136), Dissociation of phospho-ERK-1:MEK1 (REACT_81846), ERK5 is activated (REACT_12075), Inactivation of MEK1 by p34cdc2 (REACT_101920), activated human MKK3/MKK6 phosphorylates p38 MAPK complexed with MAPKAPK2 or MAPKAPK3 (REACT_91195), Dissociation of phospho-ERK-1:MEK1 (REACT_90859), MEK1 binds ERK-1 (REACT_1780), Nuclear translocation of catalytic domain of Mst3 (REACT_103110), Activated TAK1 phosphorylates MKK4/MKK7 (REACT_21367), TAK1 phosphorylates MKK6 (REACT_22190), phosphorylated MKK3/MKK6 migrates to nucleus (REACT_89135), phosphorylated MKK3/MKK6 migrates to nucleus (REACT_95697), phosphorylated MKK3/MKK6 migrates to nucleus (REACT_21299), MEK2 binds ERK-2 (REACT_495), MEK1 phosphorylates ERK-1 (REACT_79487), TPL2 phosphorylates MEK1, SEK1 (REACT_22271), Activated RAF1 complex binds MEK (REACT_143), Caspase-mediated cleavage of MASK (REACT_13636), activated human MKK3/MKK6 phosphorylates p38 MAPK complexed with MAPKAPK2 or MAPKAPK3 (REACT_21395), Inactivation of MEK1 by p34cdc2 (REACT_1836), Phosphorylation of human JNKs by activated MKK4/MKK7 (REACT_6896), Inactivation of MEK1 by p34cdc2 (REACT_101930), MEK1 binds ERK-1 (REACT_90149), Dissociation of phospho-ERK-1:MEK1 (REACT_1740), RAF1 phosphorylates MEK2 (REACT_1727), MEK2 phosphorylates ERK-2 (REACT_2247), Dissociation of phospho-ERK-2:MEK2 (REACT_1019), activated human MKK3/MKK6 phosphorylates p38 MAPK complexed with MAPKAPK2 or MAPKAPK3 (REACT_95515), Activation of p38 MAPK (REACT_75807), MEK1 binds ERK-1 (REACT_86136), activated human TAK1 phosphorylates MKK3/MKK6 (REACT_21338).
biological_process: Ras protein signal transduction, stress-activated MAPK cascade, apoptosis, innate immune response, toll-like receptor 1 signaling pathway, toll-like receptor 2 signaling pathway, toll-like receptor 3 signaling pathway, activation of MAPKK activity, activation of MAPK activity, ERK1 and ERK2 cascade, insulin receptor signaling pathway, toll-like receptor signaling pathway, small GTPase mediated signal transduction, JNK cascade, axon guidance, activation of innate immune response, MyD88-independent toll-like receptor signaling pathway, MyD88-dependent toll-like receptor signaling pathway, nerve growth factor receptor signaling pathway, toll-like receptor 4 signaling pathway, cellular component disassembly involved in apoptosis, nucleotide-binding oligomerization domain containing signaling pathway, epidermal growth factor receptor signaling pathway, MAPKKK cascade, Toll signaling pathway.
REACTOME_COMPLEX: MKK3:MKK6 [cytosol] (REACT_21767), MEK2:ERK-2 [cytosol] (REACT_5435), Activated RAF1 complex:MEK1 [plasma membrane] (REACT_4256), Activated RAF1 complex:MEK2 [plasma membrane] (REACT_4223), phospho-ERK-2:MEK2 [cytosol] (REACT_3199), Activated RAF1 complex:MEK [plasma membrane] (REACT_3953), MKK3-P:MKK6-P [nucleoplasm] (REACT_21457), MKK3-P:MKK6-P [cytosol] (REACT_21595), MEK1:ERK-1 [cytosol] (REACT_5539), phospho-ERK-1:MEK1 [cytosol] (REACT_2796).
REACTOME_PATHWAY: Toll Like Receptor 4 (TLR4) Cascade (REACT_109895), Toll Receptor Cascades (REACT_92498), ERK activation (REACT_80936), Prolonged ERK activation events (REACT_12005), Insulin receptor signalling cascade (REACT_30635), SHC-mediated signalling (REACT_661), Toll Like Receptor 4 (TLR4) Cascade (REACT_84510), NCAM signaling for neurite out-growth (REACT_87288), Signalling by NGF (REACT_82110), ERK activation (REACT_1482), Apoptotic execution phase (REACT_81021), MAP kinase activation in TLR cascade (REACT_82500), Axon guidance (REACT_110262), Toll Like Receptor 9 (TLR9) Cascade (REACT_104873), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_97163), Immune System (REACT_78489), Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways (REACT_75913), Down-stream signal transduction (REACT_17025), MAP kinase activation in TLR cascade (REACT_21308), Toll Like Receptor 9 (TLR9) Cascade (REACT_9047), MyD88:Mal cascade initiated on plasma membrane (REACT_92018), Toll Like Receptor TLR6:TLR2 Cascade (REACT_88205), NCAM signaling for neurite out-growth (REACT_18334), Toll Like Receptor 9 (TLR9) Cascade (REACT_32391), MyD88 dependent cascade initiated on endosome (REACT_25222), Toll Like Receptor TLR6:TLR2 Cascade (REACT_106218), activated TAK1 mediates p38 MAPK activation (REACT_21399), NCAM signaling for neurite out-growth (REACT_78289), ERK1 activation (REACT_1391), Toll Like Receptor TLR1:TLR2 Cascade (REACT_34248), Prolonged ERK activation events (REACT_33773), Apoptosis (REACT_578), NGF signalling via TRKA from the plasma membrane (REACT_29880), ERK activation (REACT_101978), MyD88 dependent cascade initiated on endosome (REACT_103436), Shc events in EGFR signaling (REACT_77142), ARMS-mediated activation (REACT_84489), ERK2 activation (REACT_90463), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_9020), NGF signalling via TRKA from the plasma membrane (REACT_12056), MyD88:Mal cascade initiated on plasma membrane (REACT_85347), Signalling to ERKs (REACT_12058), Signaling by Insulin receptor (REACT_78672), Toll Like Receptor 10 (TLR10) Cascade (REACT_92313), activated TAK1 mediates p38 MAPK activation (REACT_96987), Signaling by Interleukins (REACT_22232), Toll Like Receptor 2 Cascade (REACT_94528), MyD88-independent cascade initiated on plasma membrane (REACT_102299), Axon guidance (REACT_29862), Toll Like Receptor 5 (TLR5) Cascade (REACT_77972), Toll Like Receptor 5 (TLR5) Cascade (REACT_9061), Signalling to p38 via RIT and RIN (REACT_42108), Interleukin-2 signaling (REACT_27283), IRS-related events (REACT_762), Frs2-mediated activation (REACT_110941), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_102886), Signal transduction by L1 (REACT_89899), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_95028), Grb2 events in EGFR signaling (REACT_12606), Toll Receptor Cascades (REACT_6966), Activated TLR4 signalling (REACT_78833), Shc events in EGFR signaling (REACT_80014), SHC-related events (REACT_92272), RAF/MAP kinase cascade (REACT_92987), Signaling by PDGF (REACT_16888), NGF signalling via TRKA from the plasma membrane (REACT_100895), Toll Receptor Cascades (REACT_85453), Toll Receptor Cascades (REACT_91529), IRS-related events (REACT_104222), Signalling to RAS (REACT_81747), ERK2 activation (REACT_1183), RAF phosphorylates MEK (REACT_614), MyD88 cascade initiated on plasma membrane (REACT_27215), Innate Immunity Signaling (REACT_81815), Immune System (REACT_6900), MyD88:Mal cascade initiated on plasma membrane (REACT_86913), MyD88-independent cascade initiated on plasma membrane (REACT_78892), Signaling by PDGF (REACT_109659), Immune System (REACT_97310), Prolonged ERK activation events (REACT_91625), Down-stream signal transduction (REACT_88006), Signalling to RAS (REACT_12033), Signalling to RAS (REACT_79426), MyD88 cascade initiated on plasma membrane (REACT_93873), IRS-mediated signalling (REACT_97132), Toll Like Receptor 5 (TLR5) Cascade (REACT_30810), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_97258), Toll Like Receptor 5 (TLR5) Cascade (REACT_78753), Toll Like Receptor 2 Cascade (REACT_7980), Signalling by NGF (REACT_11061), Insulin receptor signalling cascade (REACT_1195), IRS-mediated signalling (REACT_81492), Toll Like Receptor 10 (TLR10) Cascade (REACT_82644), ERK1 activation (REACT_30605), Signaling by EGFR (REACT_89544), Grb2 events in EGFR signaling (REACT_33317), Down-stream signal transduction (REACT_79504), Signal transduction by L1 (REACT_94201), SHC-mediated signalling (REACT_81076), Frs2-mediated activation (REACT_85533), activated TAK1 mediates p38 MAPK activation (REACT_87442), Toll Like Receptor TLR1:TLR2 Cascade (REACT_91838), L1CAM interactions (REACT_89546), Signalling to ERK5 (REACT_12020), JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 (REACT_32253), Cytokine Signaling in Immune system (REACT_75790), Toll Like Receptor 2 Cascade (REACT_32312), SHC-related events (REACT_85436), Signalling to ERKs (REACT_32318), ERK1 activation (REACT_79430), Toll Like Receptor TLR6:TLR2 Cascade (REACT_8006), Toll Like Receptor TLR1:TLR2 Cascade (REACT_8005), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_78006), Toll Like Receptor TLR6:TLR2 Cascade (REACT_106314), Toll Like Receptor TLR1:TLR2 Cascade (REACT_101461), Signal transduction by L1 (REACT_22272), NOD1/2 Signaling Pathway (REACT_75776), MEK activation (REACT_962), RAF/MAP kinase cascade (REACT_85806), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_34570), ERK2 activation (REACT_81711), Toll Like Receptor 4 (TLR4) Cascade (REACT_6894), IRS-related events (REACT_87578), Signalling by NGF (REACT_97378), Apoptosis (REACT_100045), Signaling by PDGF (REACT_106012), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_102363), Toll Like Receptor 2 Cascade (REACT_109018), MyD88-independent cascade initiated on plasma membrane (REACT_99643), Toll Like Receptor 10 (TLR10) Cascade (REACT_31842), MyD88 cascade initiated on plasma membrane (REACT_81183), Activated TLR4 signalling (REACT_90914), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_88341), Toll Like Receptor 3 (TLR3) Cascade (REACT_99649), IRS-mediated signalling (REACT_332), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_25024), Toll Like Receptor 9 (TLR9) Cascade (REACT_107954), Immune System (REACT_105951), Toll Like Receptor 3 (TLR3) Cascade (REACT_105689), Axon guidance (REACT_18266), MAP kinase activation in TLR cascade (REACT_85645), SHC-mediated signalling (REACT_78477), ARMS-mediated activation (REACT_109866), SOS-mediated signalling (REACT_524), MyD88 cascade initiated on plasma membrane (REACT_88909), MyD88 dependent cascade initiated on endosome (REACT_87458), Signaling by Insulin receptor (REACT_6313), Grb2 events in EGFR signaling (REACT_83336), Signalling to p38 via RIT and RIN (REACT_12077), Frs2-mediated activation (REACT_12076), Shc events in EGFR signaling (REACT_12579), JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 (REACT_21368), SOS-mediated signalling (REACT_83934), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_34578), Signaling by EGFR (REACT_89866), Signaling by EGFR (REACT_9417), ARMS-mediated activation (REACT_12002), Innate Immunity Signaling (REACT_90618), L1CAM interactions (REACT_22205), RAF/MAP kinase cascade (REACT_634), Interleukin-1 signaling (REACT_22442), Toll Like Receptor 10 (TLR10) Cascade (REACT_9027), Insulin receptor signalling cascade (REACT_90766), Toll Like Receptor 3 (TLR3) Cascade (REACT_96401), Toll Like Receptor 3 (TLR3) Cascade (REACT_6783), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_6782), Innate Immunity Signaling (REACT_88681), Signaling by Insulin receptor (REACT_498), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_96313), MyD88:Mal cascade initiated on plasma membrane (REACT_6788), Apoptotic cleavage of cellular proteins (REACT_107), Signalling to ERKs (REACT_82045), Activated TLR4 signalling (REACT_6890), Signalling to p38 via RIT and RIN (REACT_77940), Activated TLR4 signalling (REACT_87317), SHC-related events (REACT_999), MyD88-independent cascade initiated on plasma membrane (REACT_6809), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_88077), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_25281), Apoptotic execution phase (REACT_995), Innate Immunity Signaling (REACT_6802), MyD88 dependent cascade initiated on endosome (REACT_94468), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_79068), Toll Like Receptor 4 (TLR4) Cascade (REACT_79117), SOS-mediated signalling (REACT_99222), L1CAM interactions (REACT_94606), MAP kinase activation in TLR cascade (REACT_32136).
These properties come from phylome analysis
molecular_function: ATP binding, protein serine/threonine kinase activity.
biological_process: protein phosphorylation.
These properties come from blast2go analysis
molecular_function: ATP binding, protein binding, protein serine/threonine kinase activity.
biological_process: protein phosphorylation.
This polypeptide in other databases
In PhylomeDB is Phy003LI1J_CUCME .