Polypeptide MELO3C002326P1
Accession: MELO3C002326P1
Name: MELO3C002326P1
Description: Similar to DNA-(apurinic or apyrimidinic site) lyase (Rattus norvegicus) (uniprot_sprot:sp|P43138|APEX1_RAT)
Sequence:
>MELO3C002326P1 Similar to DNA-(apurinic or apyrimidinic site) lyase (Rattus norvegicus) (uniprot_sprot:sp|P43138|APEX1_RAT) MKRFFKPIEKEGSSKKPALSPSLKDNDDDSELSAPDKKEPLKFVTWNANSLLLRVKNDWPEFTKFVTNLDPDAIAIQEVR IPAAGSKGASKNQGELKDDTNISREEKQMLMRALSSPPFANYRVWWSLSDSKYAGTALFIKKCFQPKKVFFNLDRIASKH EVDGRVILAEFETFRLLNTYSPNNGWKEEEKSFKRRRKWDKRMLEFVIQSSDKPLIWCGDLNVSHEEIDVSHPDFFSAAK LNGYIPPNKEDCGQPGFTLAERNRFNAILKEGKLIDAYRYLHKEKDMERGFSWSGHPIGKYRGKRMRIDYFIVSESLVGR IVSCEMHGQGIELKGFYGSDHCPVSLELSEASSCPESQKN*
Download fasta sequence.
Properties
These properties come from reactome analysis
biological_process: base-excision repair, DNA repair.
REACTOME_REACTION: Displacement of UNG2 glycosylase by APE1 at the AP site (REACT_1588), Displacement of hNTH1 glycosylase by APE1 at the AP site (REACT_104073), Displacement of hNTH1 glycosylase by APE1 at the AP site (REACT_94324), POL delta associates with AP site displacing POL Beta (REACT_2121), Recruitment of POL Beta to the AP site (REACT_344), Displacement of MPG glycosylase by APE1 at the AP site (REACT_1527), Displacement of hNTH1 glycosylase by APE1 at the AP site (REACT_2097), APE1 mediated endonucleolytic cleavage at the 5 side of the base-free deoxyribose residue (REACT_31548), Displacement of hSMUG1 glycosylase by APE1 at the AP site (REACT_101852), Displacement of MBD4 glycosylase by APE1 at the AP site (REACT_1057), Displacement of TDG glycosylase by APE1 at the AP site (REACT_89627), Displacement of hOGG1 glycosylase by APE1 at the AP site (REACT_54), Ligation of DNA at sites of patch replacement (REACT_1247), Interaction of APE1 with DNA ligase I (REACT_1688), Interaction of APE1 with DNA ligase I (REACT_79625), APE1 mediated endonucleolytic cleavage at the 5 side of the base-free deoxyribose residue (REACT_1964), Displacement of hSMUG1 glycosylase by APE1 at the AP site (REACT_1148), Displacement of hOGG1 glycosylase by APE1 at the AP site (REACT_96335), Excision of the abasic sugar phosphate (dRP) residue at the strand break (REACT_1215), Displacement of MYH glycosylase by APE1 at the AP site (REACT_1894), Cleavage of flap structures (REACT_2189), Interaction of APE1 with FEN1 (REACT_1114), POL Beta mediated incorporation of the first replacement nucleotide (REACT_2224), Interaction of APE1 with FEN1 (REACT_80793), APE1 mediated endonucleolytic cleavage at the 5 side of the base-free deoxyribose residue (REACT_85019), Interaction of APE1 with DNA ligase I (REACT_91895), Interaction of APE1 with FEN1 (REACT_82222), DNA strand displacement synthesis (REACT_41), Displacement of TDG glycosylase by APE1 at the AP site (REACT_1239).
REACTOME_COMPLEX: APE1-bound DNA strand break containing an incision 5 to an AP site [nucleoplasm] (REACT_5549), APE1:FEN1 complex [nucleoplasm] (REACT_4220), Ligated patch-repaired DNA [nucleoplasm] (REACT_5348), POL Beta: APE1-bound DNA strand break containing incision 5 to AP site [nucleoplasm] (REACT_3091), DNA containing unligated replacement-synthesized patch [nucleoplasm] (REACT_3364), single-stranded DNA flap structure at the site of damaged residue [nucleoplasm] (REACT_2352), POL Beta: APE1-bound 5 incised DNA strand break containing first resynthesized base [nucleoplasm] (REACT_2384), POL Delta:APE1-bound 5 incised DNA strand break containing first resynthesized nucleotide [nucleoplasm] (REACT_3786), DNA containing an APE1-bound AP site [nucleoplasm] (REACT_5506), APE1:DNA ligase I complex [nucleoplasm] (REACT_2969).
REACTOME_PATHWAY: Resolution of AP sites via the single-nucleotide replacement pathway (REACT_100243), Resolution of AP sites via the multiple-nucleotide patch replacement pathway (REACT_99623), Removal of DNA patch containing abasic residue (REACT_31716), DNA Repair (REACT_91442), Base Excision Repair (REACT_1104), Removal of DNA patch containing abasic residue (REACT_2192), DNA Repair (REACT_88201), Resolution of AP sites via the single-nucleotide replacement pathway (REACT_85554), Base-free sugar-phosphate removal via the single-nucleotide replacement pathway (REACT_30338), Displacement of DNA glycosylase by APE1 (REACT_1064), Base Excision Repair (REACT_34413), Resolution of Abasic Sites (AP sites) (REACT_93432), Base-free sugar-phosphate removal via the single-nucleotide replacement pathway (REACT_85229), Resolution of AP sites via the multiple-nucleotide patch replacement pathway (REACT_1128), Displacement of DNA glycosylase by APE1 (REACT_77083), Resolution of Abasic Sites (AP sites) (REACT_1893), Base Excision Repair (REACT_105824), Resolution of Abasic Sites (AP sites) (REACT_103045), Displacement of DNA glycosylase by APE1 (REACT_93009), Base-free sugar-phosphate removal via the single-nucleotide replacement pathway (REACT_1357), DNA Repair (REACT_216), Resolution of AP sites via the multiple-nucleotide patch replacement pathway (REACT_28683), Resolution of AP sites via the single-nucleotide replacement pathway (REACT_933), Removal of DNA patch containing abasic residue (REACT_30076).
These properties come from phylome analysis
molecular_function: metal ion binding, chromatin DNA binding, site-specific endodeoxyribonuclease activity, specific for altered base, oxidoreductase activity, 3'-5' exonuclease activity, phosphoric diester hydrolase activity, protein binding, uracil DNA N-glycosylase activity, phosphodiesterase I activity, exonuclease activity, ribonuclease H activity, endodeoxyribonuclease activity, nuclease activity, DNA-(apurinic or apyrimidinic site) lyase activity, RNA binding, transcription corepressor activity, transcription coactivator activity, damaged DNA binding, DNA binding, exodeoxyribonuclease III activity, endonuclease activity.
cellular_component: perinuclear region of cytoplasm, nuclear speck, chloroplast, ribosome, centrosome, endoplasmic reticulum, mitochondrion, nucleolus, nucleoplasm, nucleus, intracellular.
biological_process: regulation of DNA binding, positive regulation of anti-apoptosis, positive regulation of DNA repair, regulation of mRNA stability, growth, embryo development ending in birth or egg hatching, transcription from RNA polymerase II promoter, regulation of transcription, DNA-dependent, transcription, DNA-dependent, DNA recombination, base-excision repair, nematode larval development, DNA repair.
These properties come from blast2go analysis
molecular_function: exodeoxyribonuclease III activity, endonuclease activity.
biological_process: DNA repair.
This polypeptide in other databases
In PhylomeDB is Phy003AD9Y_CUCME .
