Polypeptide MELO3C002388P1
Accession: MELO3C002388P1
Name: MELO3C002388P1
Description: Similar to Calnexin homolog 1 (Arabidopsis thaliana) (uniprot_sprot:sp|P29402|CALX1_ARATH)
Sequence:
>MELO3C002388P1 Similar to Calnexin homolog 1 (Arabidopsis thaliana) (uniprot_sprot:sp|P29402|CALX1_ARATH) MKAVHLGLAAALLVLCLSFVQLRASNDEIFYDSFDESFEGRWIVSEKDDYQGVWKHSKSEGHDDYGLLVSEKARKYAIVN ELDEPVSLKDGTVVLQFETRLQNGLECGGAYLKYLRPQDAGWKAKEFDNESPYSIMFGPDKCGATNKVHFIVKHKNPKTG EYAEHHLKNPPSVPADKLSHVYTAILESGNSVRILIDGSEKKKANFLSEDDFEPPIIPAKTIADPDDKKPEDWDERAKIP DPNAVKPDDWDEDAPIEIVDEEAEKPEGWLDDEPEEIDDPEATKPEDWDDEEDGEWEAPKIDNPKCETAPGCGEWKKPMK RNPEYKGKWHAPEIDNPNYKGIWKPRQIPNPSYFEIEKPDFDPVAAIGIEIWTMQDGILFDNILIAKDEKLATSYRDEKW KPKFEVEKEKQKAEEAAAGGPDGLAEYQKKVFDVLYKIADISFLSQYRSKIIDVIEKGEKQPNLTIGIIVSIVVVIFTIL LRLVFGGKKQQPAKREEKSTVAAESSSDQSSSGEKEGEEKEDGGAAAPPRRRSGPRRDN*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: unfolded protein binding, sugar binding, calcium ion binding.
cellular_component: cytoplasmic membrane-bounded vesicle, integral to membrane, plant-type cell wall, microsome, endoplasmic reticulum membrane.
biological_process: protein folding.
These properties come from reactome analysis
REACTOME_REACTION: Interaction of beta-2-microglobulin (B2M) chain with class I HC (REACT_75898), Binding of ERp57 (REACT_23831), Binding of newly synthesized MHC class I heavy chain (HC) with calnexin (REACT_75754), Interaction of Erp57 with MHC class I HC (REACT_75930), Binding of calnexin/calreticulin to the unfolded protein (REACT_23778), Removal of the third glucose by glucosidase II and release from the chaperone (REACT_23791).
REACTOME_PATHWAY: Post-translational protein modification (REACT_22161), Adaptive Immunity Signaling (REACT_75774), Antigen Presentation: Folding, assembly and peptide loading of class I MHC (REACT_75795), Metabolism of proteins (REACT_17015), Calnexin/calreticulin cycle (REACT_23810), Immune System (REACT_6900), Asparagine N-linked glycosylation (REACT_22426), Class I MHC mediated antigen processing & presentation (REACT_75820), N-glycan trimming in the ER and Calnexin/Calreticulin cycle (REACT_23878).
REACTOME_COMPLEX: calnexin/calreticulin [endoplasmic reticulum lumen] (REACT_24766), unfolded protein:(Glc)1 (GlcNAc)2 (Man)9 (Asn)1:chaperone:ERp57 [endoplasmic reticulum lumen] (REACT_24059), monoglucosylated MHC class I HC:Calnexin/BiP [integral to lumenal side of endoplasmic reticulum membrane, endoplasmic reticulum lumen] (REACT_76535), MHC class I HC:Calnexin/BiP:Erp57 [integral to lumenal side of endoplasmic reticulum membrane, endoplasmic reticulum lumen] (REACT_76380), unfolded protein:(Glc)1 (GlcNAc)2 (Man)9 (Asn)1:chaperone [endoplasmic reticulum lumen] (REACT_24814), unfolded protein:glycan:chaperone:ERp57 [endoplasmic reticulum lumen] (REACT_24597).
biological_process: protein N-linked glycosylation via asparagine, post-translational protein modification, cellular protein metabolic process, antigen processing and presentation of peptide antigen via MHC class I, protein folding.
These properties come from phylome analysis
molecular_function: unfolded protein binding, sugar binding, calcium ion binding.
cellular_component: integral to endoplasmic reticulum membrane, chloroplast, plasma membrane, endoplasmic reticulum, vacuolar membrane, integral to membrane, endoplasmic reticulum membrane.
biological_process: ER-associated protein catabolic process, embryo development ending in birth or egg hatching, protein folding.
These properties come from kegg analysis
KEGG_PATHWAY: Antigen processing and presentation (ko04612).
KEGG_ORTHOLOGS: calnexin (K08054).
This polypeptide in other databases
In PhylomeDB is Phy003ADDT_CUCME .