Polypeptide MELO3C002456P1

Accession: MELO3C002456P1

Name: MELO3C002456P1

Description: Similar to ATP synthase gamma chain, chloroplastic (Nicotiana tabacum) (uniprot_sprot:sp|P29790|ATPG_TOBAC)

Sequence:

>MELO3C002456P1 Similar to ATP synthase gamma chain, chloroplastic (Nicotiana tabacum) (uniprot_sprot:sp|P29790|ATPG_TOBAC)
MSCSNLTMWVTSKPTVSDASSLSFRSFLSPFQLPSQNSTPARSWSVSPIHCGLRELRDRIDSVKNTQKITEAMKLVAAAK
VRRAQEAVVNGRPFSEALVEVLYNINEQLQTEDVDVPLTKVRPVKKVALVVVTGDRGLCGGFNNTIIKKAEARISELKAL
GLDYTVISVGKKGNSYFLRRPYIPVDKFLEGGTLPTAKEAQAIADDVFSLFVSEEVDKVELLYTKFVSLVKSDPVIHTLL
PLSPKGEICDINGVCVDAAEDEFFRLTTKEGKLTVERDSVRTSTSDFSPILEFEQDPVQILDALLPLYLNSQILRALQES
LASELAARMSAMSNATDNASELKRTLSIVYNRQRQAKITGEILEIVAGANALT*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: proton-transporting ATPase activity, rotational mechanism, hydrogen ion transporting ATP synthase activity, rotational mechanism.

cellular_component: proton-transporting ATP synthase complex, catalytic core F(1), chloroplast envelope, chloroplast thylakoid membrane.

biological_process: ATP synthesis coupled proton transport.

These properties come from reactome analysis


REACTOME_REACTION: ADP and Pi bind to ATPase (REACT_991), ATP is synthesized from ADP and Pi by ATPase (REACT_190), Enzyme-bound ATP is released (REACT_1985).

REACTOME_PATHWAY: Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_6305), Formation of ATP by chemiosmotic coupling (REACT_6759).

REACTOME_COMPLEX: ATPase complex [mitochondrial inner membrane] (REACT_4862), ATPase CF(1) [mitochondrial matrix] (REACT_3000), ATPase-ADP and Pi complex [mitochondrial inner membrane] (REACT_2435), ATPase-ATP complex [mitochondrial inner membrane] (REACT_3945).

biological_process: respiratory electron transport chain, mitochondrial ATP synthesis coupled proton transport.

These properties come from kegg analysis


KEGG_ORTHOLOGS: F-type H+-transporting ATPase subunit gamma [EC:3.6.3.14] (K02115).

molecular_function: proton-transporting ATPase activity, rotational mechanism, hydrogen ion transporting ATP synthase activity, rotational mechanism.

COG: F0F1-type ATP synthase, gamma subunit (COG0224).

Locations

Located in CM3.5_scaffold00001 from 3653581 to 3654702.

This polypeptide in other databases

In PhylomeDB is Phy003AEC8_CUCME .

Related features