Polypeptide MELO3C002481P1

Accession: MELO3C002481P1

Name: MELO3C002481P1

Description: Similar to Polyubiquitin 10 (Arabidopsis thaliana) (uniprot_sprot:sp|Q8H159|UBQ10_ARATH)

Sequence:

>MELO3C002481P1 Similar to Polyubiquitin 10 (Arabidopsis thaliana) (uniprot_sprot:sp|Q8H159|UBQ10_ARATH)
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF
VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL
TGKTITLEVESSDTIDNVKAKIQDKEDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: protein binding.

These properties come from reactome analysis


REACTOME_PATHWAY: Eukaryotic Translation Elongation (REACT_108858), Signaling by EGFR (REACT_9417), Antigen processing: Ubiquitination & Proteasome degradation (REACT_75842), Innate Immunity Signaling (REACT_6802), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_25281), Formation of a pool of free 40S subunits (REACT_1797), MyD88-independent cascade initiated on plasma membrane (REACT_6809), Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins (REACT_107040), Cap-dependent Translation Initiation (REACT_100314), M/G1 Transition (REACT_1725), TRAF6 mediated IRF7 activation (REACT_24938), NF-kB is activated and signals survival (REACT_13696), CDT1 association with the CDC6:ORC:origin complex (REACT_1949), Activated TLR4 signalling (REACT_6890), Assembly of the pre-replicative complex (REACT_2243), APC-Cdc20 mediated degradation of Nek2A (REACT_108212), Toll Like Receptor 4 (TLR4) Cascade (REACT_6894), Orc1 removal from chromatin (REACT_93416), MyD88:Mal cascade initiated on plasma membrane (REACT_6788), Vif-mediated degradation of APOBEC3G (REACT_9453), Eukaryotic Translation Initiation (REACT_33969), Eukaryotic Translation Elongation (REACT_82124), Autodegradation of Cdh1 by Cdh1:APC/C (REACT_6785), Regulation of DNA replication (REACT_829), DNA Replication (REACT_101407), APC/C:Cdc20 mediated degradation of mitotic proteins (REACT_6781), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_6782), Toll Like Receptor 3 (TLR3) Cascade (REACT_6783), Peptide chain elongation (REACT_96957), Fanconi Anemia pathway (REACT_18410), Toll Like Receptor 10 (TLR10) Cascade (REACT_9027), Interleukin-1 signaling (REACT_22442), SCF-beta-TrCP mediated degradation of Emi1 (REACT_106884), Peptide chain elongation (REACT_105694), Cyclin A:Cdk2-associated events at S phase entry (REACT_9029), Regulation of APC/C activators between G1/S and early anaphase (REACT_6837), Cyclin E associated events during G1/S transition (REACT_1574), Regulation of mitotic cell cycle (REACT_78703), G1/S Transition (REACT_1783), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_105871), Eukaryotic Translation Elongation (REACT_1477), EGFR downregulation (REACT_12484), Eukaryotic Translation Initiation (REACT_77252), JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 (REACT_21368), p75NTR signals via NF-kB (REACT_13537), Orc1 removal from chromatin (REACT_1156), Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins (REACT_6954), Fanconi Anemia pathway (REACT_98621), Translation (REACT_1014), APC/C:Cdc20 mediated degradation of Securin (REACT_92044), Synthesis of DNA (REACT_29294), TAK1 activates NFkB by phosphorylation and activation of IKKs complex (REACT_21281), Nonsense Mediated Decay Independent of the Exon Junction Complex (REACT_75768), p53-Independent DNA Damage Response (REACT_2160), TRAF6 mediated induction of TAK1 complex (REACT_25351), Diabetes pathways (REACT_106636), Cell Cycle, Mitotic (REACT_53493), RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways (REACT_25359), Regulation of mitotic cell cycle (REACT_21279), Regulation of mitotic cell cycle (REACT_33905), MyD88 dependent cascade initiated on endosome (REACT_25222), Regulation of the Fanconi anemia pathway (REACT_18265), Formation of a pool of free 40S subunits (REACT_87090), APC-Cdc20 mediated degradation of Nek2A (REACT_8017), Vpu mediated degradation of CD4 (REACT_9031), Regulation of APC/C activators between G1/S and early anaphase (REACT_103190), Endosomal Sorting Complex Required For Transport (ESCRT) (REACT_27258), APC/C-mediated degradation of cell cycle proteins (REACT_80330), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_25024), TRAF3-dependent IRF activation pathway (REACT_25026), Removal of licensing factors from origins (REACT_81377), APC/C-mediated degradation of cell cycle proteins (REACT_6828), NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10 (REACT_25039), Autodegradation of Cdh1 by Cdh1:APC/C (REACT_81946), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_110187), SCF-beta-TrCP mediated degradation of Emi1 (REACT_6821), APC/C:Cdc20 mediated degradation of Cyclin B (REACT_6820), S Phase (REACT_899), Signaling by EGFR (REACT_89544), Translation (REACT_100851), 3 -UTR-mediated translational regulation (REACT_28457), Signalling by NGF (REACT_97378), Regulation of activated PAK-2p34 by proteasome mediated degradation (REACT_13464), S Phase (REACT_89318), Insulin Synthesis and Processing (REACT_15550), Cell Cycle, Mitotic (REACT_108233), DNA Replication Pre-Initiation (REACT_734), IRAK1 recruits IKK comlex upon TLR7/8 or 9 stimulation (REACT_25354), APC/C:Cdc20 mediated degradation of Cyclin B (REACT_33104), p75 NTR receptor-mediated signalling (REACT_13776), Regulation of DNA replication (REACT_101505), Adaptive Immunity Signaling (REACT_75774), Signaling by EGFR (REACT_89866), NOD1/2 Signaling Pathway (REACT_75776), Toll Like Receptor TLR1:TLR2 Cascade (REACT_8005), Toll Like Receptor TLR6:TLR2 Cascade (REACT_8006), Metabolism of mRNA (REACT_20605), p53-Independent G1/S DNA damage checkpoint (REACT_1208), SCF(Skp2)-mediated degradation of p27/p21 (REACT_9003), Synthesis of DNA (REACT_31294), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_79537), G1/S DNA Damage Checkpoints (REACT_2254), Cap-dependent Translation Initiation (REACT_2099), 3 -UTR-mediated translational regulation (REACT_1762), Metabolism of proteins (REACT_85873), Cdc20:Phospho-APC/C mediated degradation of Cyclin A (REACT_6850), Diabetes pathways (REACT_97252), IRAK1 recruits IKK comlex (REACT_24918), APC/C:Cdc20 mediated degradation of mitotic proteins (REACT_88485), Downstream TCR signaling (REACT_12555), APC/C-mediated degradation of cell cycle proteins (REACT_77053), Cytokine Signaling in Immune system (REACT_75790), NF-kB is activated and signals survival (REACT_104280), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_91277), Switching of origins to a post-replicative state (REACT_2148), Formation of a pool of free 40S subunits (REACT_103868), Regulation of DNA replication (REACT_77955), Signaling by Wnt (REACT_89971), Orc1 removal from chromatin (REACT_83036), Cap-dependent Translation Initiation (REACT_94881), DNA Repair (REACT_88201), Peptide chain elongation (REACT_32702), Degradation of beta-catenin by the destruction complex (REACT_11063), Signalling by NGF (REACT_11061), Toll Like Receptor 2 Cascade (REACT_7980), Signaling by Wnt (REACT_82742), Metabolism of proteins (REACT_17015), Removal of licensing factors from origins (REACT_88042), TRAF6 mediated NF-kB activation (REACT_24969), DNA Repair (REACT_216), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_2085), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_97139), TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling (REACT_25120), HIV Infection (REACT_6185), IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation (REACT_25018), DNA Replication (REACT_106731), Regulation of DNA replication (REACT_107026), Immune System (REACT_6900), Gene Expression (REACT_108313), Synthesis of DNA (REACT_2014), Insulin Synthesis and Processing (REACT_98391), Eukaryotic Translation Initiation (REACT_2159), Gene Expression (REACT_98256), Eukaryotic Translation Termination (REACT_1986), Association of licensing factors with the pre-replicative complex (REACT_1181), DNA Replication (REACT_101785), S Phase (REACT_81914), Gene Expression (REACT_71), S Phase (REACT_78838), Degradation of beta-catenin by the destruction complex (REACT_89447), Removal of licensing factors from origins (REACT_207), Cell Cycle, Mitotic (REACT_152), Translation (REACT_77710), APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 (REACT_6761), Toll Receptor Cascades (REACT_6966), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_79), Ubiquitin Mediated Degradation of Phosphorylated Cdc25A (REACT_1614), Nonsense Mediated Decay Enhanced by the Exon Junction Complex (REACT_75822), p53-Dependent G1/S DNA damage checkpoint (REACT_85), Cdc20:Phospho-APC/C mediated degradation of Cyclin A (REACT_82008), Eukaryotic Translation Elongation (REACT_81624), Cell Cycle, Mitotic (REACT_96281), Nonsense-Mediated Decay (REACT_75886), NRIF signals cell death from the nucleus (REACT_13643), p75NTR signals via NF-kB (REACT_83278), Eukaryotic Translation Termination (REACT_32804), Regulation of Apoptosis (REACT_13648), Toll Like Receptor 5 (TLR5) Cascade (REACT_9061), Cell death signalling via NRAGE, NRIF and NADE (REACT_13720), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_102684), Cap-dependent Translation Initiation (REACT_110387), Signaling by Interleukins (REACT_22232), MyD88 cascade initiated on plasma membrane (REACT_27215), Ubiquitin-dependent degradation of Cyclin D (REACT_938), Diabetes pathways (REACT_15380), Gene Expression (REACT_105649), Metabolism of RNA (REACT_21257), Peptide chain elongation (REACT_1404), Switching of origins to a post-replicative state (REACT_83310), Insulin Synthesis and Processing (REACT_92168), Host Interactions of HIV factors (REACT_6288), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_9020), IRAK2 mediated activation of TAK1 complex (REACT_25380), Viral dsRNA:TLR3:TRIF Complex Activates RIP1 (REACT_6976), p75 NTR receptor-mediated signalling (REACT_93200), Synthesis of DNA (REACT_29575), APC/C:Cdc20 mediated degradation of Securin (REACT_6871), Eukaryotic Translation Termination (REACT_93205), Regulation of APC/C activators between G1/S and early anaphase (REACT_28152), Autodegradation of the E3 ubiquitin ligase COP1 (REACT_20549), Cell Cycle Checkpoints (REACT_1538), CDK-mediated phosphorylation and removal of Cdc6 (REACT_1221), Cell Cycle, Mitotic (REACT_84794), p53-Dependent G1 DNA Damage Response (REACT_1625), TCR signaling (REACT_12526), 3 -UTR-mediated translational regulation (REACT_81650), EGFR downregulation (REACT_29383), Apoptosis (REACT_578), Switching of origins to a post-replicative state (REACT_84267), Translation (REACT_81833), Removal of licensing factors from origins (REACT_98372), Membrane Trafficking (REACT_11123), activated TAK1 mediates p38 MAPK activation (REACT_21399), Formation of a pool of free 40S subunits (REACT_107540), Degradation of beta-catenin by the destruction complex (REACT_81971), EGFR downregulation (REACT_98920), 3 -UTR-mediated translational regulation (REACT_45663), Diabetes pathways (REACT_32886), Mitotic M-M/G1 phases (REACT_21300), APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 (REACT_94396), Stabilization of p53 (REACT_309), Orc1 removal from chromatin (REACT_105679), Negative regulators of RIG-I/MDA5 signaling (REACT_25271), MAP kinase activation in TLR cascade (REACT_21308), Metabolism of proteins (REACT_86658), Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways (REACT_75913), Mitotic G1-G1/S phases (REACT_21267), Insulin Synthesis and Processing (REACT_93978), Ubiquitin-dependent degradation of Cyclin D1 (REACT_4), Signaling by Wnt (REACT_11045), Class I MHC mediated antigen processing & presentation (REACT_75820), Metabolism of proteins (REACT_91052), SCF-beta-TrCP mediated degradation of Emi1 (REACT_93035), Eukaryotic Translation Initiation (REACT_98138), Switching of origins to a post-replicative state (REACT_83424), DNA Replication (REACT_383), IKK complex recruitment mediated by RIP1 (REACT_25374), Toll Like Receptor 9 (TLR9) Cascade (REACT_9047).

REACTOME_REACTION: Ubiquitination of PAK-2p34 (REACT_13487), Translocation of ub-FANCD2 and ub-FANCI to chromatin (REACT_18327), RIP2 is K63 polyubiquitinated (REACT_75843), Phosphorylated Orc1 is ubiquitinated while still associated with chromatin (REACT_92334), Multi-ubiquitination of phospho-beta-catenin by SCF-beta-TrCP1 (REACT_101640), Recruitment of caspase-8 and -10 to FADD complex (REACT_25167), Activation of TAK1 complex bound to activated TLR4:TRAM:TRIF:pUb-TRAF6 (REACT_25288), Signal Recognition (Preprolactin) (REACT_20565), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_1654), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_103298), The 60S subunit joins the translation initiation complex (REACT_83133), Activation of IKK complex (REACT_12581), Hydrolysis of eEF1A:GTP (REACT_31709), Ubiquitination of Cyclin B by phospho-APC/C:Cdc20 complex (REACT_97971), Multiubiquitination of Nek2A (REACT_84110), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_29512), Hydrolysis of eEF1A:GTP (REACT_552), UPF1 Binds an mRNP with a Termination Codon Preceding an Exon Junction Complex (REACT_75753), Recruitment of TRAF3 to IPS-1 (REACT_25364), Cbl-mediated ubiquitination of CIN85 (REACT_93940), Cargo Recognition And Sorting (REACT_27272), Ubiquitination of Cyclin D1 (REACT_715), Phosphorylation and release of IRF3/IRF7 (REACT_25368), Ubiquitination of phospho-p27/p21 (REACT_9026), Cbl-mediated ubiquitination of CIN85 (REACT_12520), The 60S subunit joins the translation initiation complex (REACT_198), Activated TAK1 phosphorylates MKK4/MKK7 (REACT_21367), The geminin component of geminin:Cdt1 complexes is ubiquitinated, releasing Cdt1 (REACT_1787), Auto phosphorylation of TAK1 bound to p-IRAK2:pUb oligo-TRAF6: free K63 pUb:TAB1:TAB2/TAB3 upon TLR7/8 or 9 activation (REACT_25111), Activation of IKK by MEKK1 (REACT_24935), NLRC5 interacts with RIG-I/MDA5 and inhibit IPS-1 binding (REACT_25113), Ubiquitination of Emi1 by SCF-beta-TrCP (REACT_89304), TBK1/IKK epsilon complex interacts with IPS-1 bound TRAF3 (REACT_25051), Dissociation of L13a from the 60s ribosomal subunit (REACT_109051), Cleavage of the Signal Peptide of Preproinsulin (REACT_15421), Multi-ubiquitination of phospho-beta-catenin by SCF-beta-TrCP1 (REACT_31397), eIF5B:GTP is hydrolyzed and released (REACT_29113), K63-linked ubiquitination of RIP1 bound to the activated TLR4:TRAM:TRIF complex (REACT_6884), Ubiquitination of cell cycle proteins targeted by the APC/C:Cdh1complex (REACT_28669), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_109127), Ubiquitination of PAK-2p34 (REACT_13600), Polyubiquitinated NRIF migrates to the nucleus (REACT_13601), Multiubiquitination of APC/C-associated Cdh1 (REACT_6791), RIP2 induces K63-linked ubiquitination of NEMO (REACT_75924), Signal Recognition (Preprolactin) (REACT_109238), K-63-linked polyubiquitination of RIG-I (REACT_25220), E1 mediated ubiquitin activation (REACT_75782), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_104420), Pellino ubiquitinates hp-IRAK1 (REACT_24943), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_29257), Activation of NF-kB complex (REACT_12399), Ubiquitination of Securin by phospho-APC/C:Cdc20 complex (REACT_6723), Ubiquitination of Cyclin A by APC/C:Cdc20 complex (REACT_6824), Ubiquitination of Emi1 by SCF-beta-TrCP (REACT_6827), Activated TRAF6 recruits TAK1complex by binding to ubiquitin receptors of TAB2/TAB3 (REACT_6921), Signal Recognition (Preproinsulin) (REACT_110574), Ubiquitination of stimulated EGFR (Cbl:Grb2) (REACT_12562), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_2075), IkB is ubiquitinated and degraded (REACT_13676), Autoubiquitination of phospho-COP1(Ser-387 ) (REACT_20581), Signal Recognition (Preproinsulin) (REACT_89495), Release of 40S and 60S subunits from the 80S ribosome (REACT_107539), Ubiquitination of Emi1 by SCF-beta-TrCP (REACT_106550), Phosphorylated TAK1 leaves activated TLR4 receptor complex (REACT_25183), Multiubiquitination of Nek2A (REACT_7995), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_94459), Interaction between SRP and SRP Receptor (REACT_95183), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_81882), Interaction between SRP and SRP Receptor (REACT_15358), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_88081), RIG-I/MDA5 interacts with IPS-1 (REACT_24957), Cbl ubiquitinates Sprouty (REACT_12381), Multi-ubiquitination of APOBEC3G (REACT_9471), Ubiquitination of Cyclin B by phospho-APC/C:Cdc20 complex (REACT_6735), Activation of recruited TAK1 within the complex viral dsRNA:TLR3:TRIF:pUb-TRAF6:TAB1:Ub-TAB2:Ub-TAB3: TAK1 (REACT_6730), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_227), Cytoplasmic phosphorylated Cdc6 is ubiquitinated by the anaphase-promoting complex (REACT_1673), Ubiquitinated Orc1 enters the cytosol (REACT_90237), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_30444), Phosphorylated Orc1 is ubiquitinated while still associated with chromatin (REACT_109431), Pellino ubiquitinates IRAK1 (REACT_22381), Release of 40S and 60S subunits from the 80S ribosome (REACT_77616), A20 deubiquitinates RIP2 (REACT_75888), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_98404), Phosphorylated Orc1 is ubiquitinated while still associated with chromatin (REACT_106300), activated human TAK1 phosphorylates MKK3/MKK6 (REACT_21338), Monoubiquitination of FANCI by the FA ubiquitin ligase complex (REACT_18367), Interaction of MEKK1 with TRAF6 (REACT_25003), TRAF6 polyubiquitinates NRIF (REACT_13488), Translocation of ribosome by 3 bases in the 3 direction (REACT_90731), Ubiquitinated Orc1 enters the cytosol (REACT_210), Release of E3 from polyubiquitinated substrate (REACT_75928), Translocation of ub-FANCD2 and ub-FANCI to chromatin (REACT_101123), Interaction of PCBP2 with MAVS/IPS-1 (REACT_24967), Multiubiquitination of APC/C-associated Cdh1 (REACT_79393), Ubiquitination of phosphorylated Cdc25A (REACT_93), Hydrolysis of eEF1A:GTP (REACT_31077), Interaction between SRP and SRP Receptor (REACT_28872), Dissociation of L13a from the 60s ribosomal subunit (REACT_940), NEMO binds polyubiquitinated IRAK1 (REACT_22256), Translocation of ribosome by 3 bases in the 3 direction (REACT_93691), Recruitment of TBK1/IKK epsilon complex to TANK:TRAF6 (REACT_25079), Activated TRAF6:p-IRAK2 interacts with TAK1 complex upon TLR7/8 or 9 stimulation (REACT_25322), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_1227), FANCD2 deubiquitination by USP1/UAF1 (REACT_18350), Polyubiquitinated TRAF6 interacts with TAK1 complex (REACT_22322), Activated TAK1 mediates phosphorylation of the IKK Complex (REACT_6935), activated TAK1 complex dissociates from the TLR3 receptor complex (REACT_22324), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_83432), Recruitment of AIP4 and K-48 ubiquitination of MAVS/IPS-1 (REACT_25398), eIF5B:GTP is hydrolyzed and released (REACT_102209), Phosphorylation and release of IRF7 (REACT_25327), Pellino ubiquitinates hp-IRAK1 upon TLR7/8 or 9 activation<br> (REACT_24976), Interaction between SRP and SRP Receptor (REACT_103640), Translocation of ribosome by 3 bases in the 3 direction (REACT_1937), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_91228), Ubiquitination of cell cycle proteins targeted by the APC/C:Cdh1complex (REACT_6914), Hydrolysis of eEF1A:GTP (REACT_105040), K63 polyubiquitinated RIP2 associates with the TAK1 complex (REACT_75887), Signal Recognition (Preprolactin) (REACT_104150), Dimerzation of procaspase-8/10 (REACT_24946), TRAF6 ubiquitinqtes IRF7 in a K63-dependent manner following TLR7/8 or 9 stimulation (REACT_25090), Translocation of ribosome by 3 bases in the 3 direction (REACT_99354), Ubiquitination of CD4 by Vpu:CD4:beta-TrCP:SKP1 complex (REACT_9063), Ubiquitinated Orc1 enters the cytosol (REACT_79323), Cbl binds and ubiquitinates Phospho-Sprouty (REACT_12432), eIF5B:GTP is hydrolyzed and released (REACT_100790), NEMO subunit of IKK complex binds to activated IRAK1 (REACT_25305), Ubiquitination of Cyclin A by APC/C:Cdc20 complex (REACT_85194), IkB is ubiquitinated and degraded (REACT_99887), The 60S subunit joins the translation initiation complex (REACT_32450), Recruitment of IRF7 to TRAF6 (REACT_25308), IPS-1 interacts with RIP-1 and FADD (REACT_25147), Transfer of ubiquitin from E1 to E2 (REACT_75860), The 60S subunit joins the translation initiation complex (REACT_101966), CYLD deubiquitinates NEMO (REACT_75903), Transfer of Ub from E2 to substrate and release of E2 (REACT_75901), Ubiquitinated Orc1 enters the cytosol (REACT_87934), RIP1 facilitates IKK complex phosphorylation (REACT_6973), MVB Vesicle Formation (REACT_27290), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_95914), Ubiquitination of Securin by phospho-APC/C:Cdc20 complex (REACT_109071), Release of 40S and 60S subunits from the 80S ribosome (REACT_86830), Phosphorylated Orc1 is ubiquitinated while still associated with chromatin (REACT_1626), Dissociation of L13a from the 60s ribosomal subunit (REACT_90144), Inhibition of RIG-I/MDA5 signaling by ATG5-ATG12 conjugate (REACT_24982), Activated TRAF6:p-IRAK2 interacts with TAK1 complex (REACT_24985), Recruitment of TRAF6/TRAF2 to IPS-1 (REACT_25262), Activated TLR4:TRAM:TRIF:K63-pUb-TRAF6 recruits TAK1complex (REACT_25261), Recruitment of TANK to TRAF6 (REACT_24986), TRAF6 auto-ubiquitinates with Lys63-linked polyubiquitin chains (REACT_22430), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_81539), Dissociation of L13a from the 60s ribosomal subunit (REACT_98170), Recruitment of IRF3/7  (REACT_25170), NEMO subunit of IKK complex binds to activated IRAK1 upon stimulation of TLR7/8 or 9. (REACT_25072), Interaction of E3 with substrate and E2-Ub complex (REACT_75856), SMG1 Phosphorylates UPF1 (Enhanced by Exon Junction Complex) (REACT_75910), eIF5B:GTP is hydrolyzed and released (REACT_3), Release of 40S and 60S subunits from the 80S ribosome (REACT_928), Monoubiquitination of FANCD2 by the FA ubiquitin ligase complex (REACT_18429), Cbl-mediated ubiquitination of CIN85 (REACT_94265), Recruitment of IKK complex (REACT_25134), Formation of UPF1:eRF3 Complex on mRNA with a Premature Termination Codon and No Exon Junction Complex (REACT_75917), Processing of caspases (REACT_24999), Auto-ubiquitination of TRAF6 (REACT_12595), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_15520), Cbl escapes Cdc42-mediated inhibition by down-regulating the adaptor molecule betaPix (REACT_12451), ESCRT Disassembly (REACT_27184), Signal Recognition (Preproinsulin) (REACT_15319), Nemo subunit of IKK complex binds polyubiquinated RIP1 (REACT_25373), Activation of TAK1-TAB2 complex (REACT_12518), Auto phosphorylation of TAK1 bound to p-IRAK2:pUb oligo-TRAF6: free K63 pUb:TAB1:TAB2/TAB3 (REACT_25375), Cargo Sequestration (REACT_27319), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_389), Polyubiquitinated NRIF binds to p62 (Sequestosome) (REACT_13460), Multi-ubiquitination of phospho-beta-catenin by SCF-beta-TrCP1 (REACT_10082), Ubiquitination of stimulated EGFR (Cbl) (REACT_12515).

REACTOME_COMPLEX: K63-linked poly-Ub-IRF7:TRAF6:hp-IRAK1:p-IRAK4:oligo-MyD88:activated TLR7/8 or 9. [endosome membrane] (REACT_26203), dsRNA:RIG-I/MDA5:K48 Ub-IPS-1:PCBP2:AIP4 [mitochondrial outer membrane] (REACT_26024), Ubiquitinated NRIF:Sequestosome [nucleoplasm] (REACT_14087), p-IRAK2:K63-linked pUb oligo-TRAF6 [endosome membrane] (REACT_26097), Preproinsulin-SRP Complex [cytosol] (REACT_15977), PAMP:NOD oligomer:RIP2:K63-pUb-K285-NEMO [cytosol] (REACT_76201), K-48-polyubiquitinated IPS-1 [mitochondrial outer membrane] (REACT_26963), multiubiquitinated cell cycle protein:APC/C:Cdh1 complex [cytosol] (REACT_7822), Phosphorylated UPF1:SMG5:SMG7:SMG6:PP2A:Translated mRNP [cytosol] (REACT_76275), K48-Ub RIG-I/MDA5 [cytosol] (REACT_25791), E3:K48-polyubiquitinated substrate [cytosol] (REACT_75972), dsRNA:RIG-I/MDA5:IPS-1:TRAF2/TRAF6:MEKK1 [mitochondrial outer membrane] (REACT_26122), Ubiquitinated Phospho-Cdc25A [cytosol] (REACT_4164), K63 linked polyubiquitin chain [cytosol] (REACT_14648), Ub:substrate [cytosol] (REACT_75992), TRAF6:K63-linked polyUb p-IRAK1:IKK complex [cytosol] (REACT_26014), dsRNA:RIG-I/MDA5:IPS-1:RIP-1/FADD:Procasp-8/10 [mitochondrial outer membrane] (REACT_26650), hp-IRAK1:K6-poly-Ub oligo-TRAF6:Activated TAK1 complex [cytosol] (REACT_23314), dsRNA:RIG-I/MDA5:IPS-1:RIP-1/FADD:procaspase-8/10 dimer [mitochondrial outer membrane] (REACT_26858), FANCD and ub-FANCI-bound chromatin [nucleoplasm] (REACT_18588), multiubiquitinated CD4:Vpu:beta-TrCP_1:Skp1 complex [endoplasmic reticulum membrane] (REACT_9344), Multiubiquitinated Nek2A [cytosol] (REACT_8451), Preproinsulin: Ribosome Nascent Complex [cytosol] (REACT_21205), dsRNA:RIG-1/MDA5:IPS-1:TRAF3 [mitochondrial outer membrane] (REACT_25597), UPF1:eRF3 Complex on Translated mRNA [cytosol] (REACT_76212), eRF3-GDP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_5057), activated TLR4:TRAM:TRIF:K63-pUb-RIP1 [plasma membrane] (REACT_25755), Poly-K63-Ub-hp-IRAK1 [endosome membrane] (REACT_25636), ESCRT-0/Cargo Complex [endosome membrane] (REACT_27808), 60s ribosomal complex lacking L13a subunit [cytosol] (REACT_4690), ESCRT-III/Cargo Complex [endosome membrane] (REACT_27876), TRAF6:K63-linked polyUb p-IRAK1:IKK complex [endosome membrane, cytosol] (REACT_25723), TAK1/TAB2 complex bound to TRAF6/CBM complex [plasma membrane] (REACT_12884), Ub-NEMO [cytosol] (REACT_12761), activated TLR4:TRAM:TRIF:K63-pUb-TRAF6 [plasma membrane] (REACT_25867), Translated mRNA Complex with Premature Termination Codon Not Preceding Exon Junction [cytosol] (REACT_76767), K48 polyubiquitinated p85-containing Class 1A PI3Ks [cytosol] (REACT_24063), dsRNA:RIG-1/MDA5:IPS-1:Ub-TRAF3:TBK1/IKKi:IRF3/IRF7 [mitochondrial outer membrane] (REACT_25519), K63 linked polyubiquitin chain [nucleoplasm] (REACT_13971), K48-polyubiquitin TRAF3 [cytosol] (REACT_26176), ubiquitinated PAK-2p34 [cytosol] (REACT_14454), K63-linked poly Ub-IRF7 [endosome membrane] (REACT_25774), Ubiquitinated NRIF:Sequestosome [cytosol] (REACT_14383), Elongation complex with growing peptide chain [cytosol] (REACT_5024), dsRNA:RIG-I/MDA5:NLRC5 [cytosol] (REACT_26732), Ubiquitinated NRIF [cytosol] (REACT_14387), Translated mRNA Complex with Premature Termination Codon Preceding Exon Junction [cytosol] (REACT_76510), E3:Ub:substrate [cytosol] (REACT_76185), PAMP:NOD oligomer:K63-polyUb-RIP2:NEMO [cytosol] (REACT_22571), EGF:Phospho-EGFR (Y1045) dimer:Phospho-CBL:CIN85 ubiquitinated:Endophilin:Epsin:Eps15R:Eps15 complex [plasma membrane] (REACT_13370), PAMP:NOD oligomer:K63-polyUb-RIP2:NEMO:activated TAK1 complex [cytosol] (REACT_23399), activated TLR4:TRAM:TRIF:K63-pUb-TRAF6:free K63-linked pUb:TAK1complex [plasma membrane, cytosol] (REACT_26036), Ubiquinated and PIP3 Endosmal Membrane Bound Cargo [endosome membrane] (REACT_27685), 80S:Met-tRNAi:mRNA:aminoacyl-tRNA [cytosol] (REACT_3365), activated TLR4:TRAM:TRIF:K63-pUb-RIP1:IKKcomplex [plasma membrane, cytosol] (REACT_26016), dsRNA:RIG-I/MDA5:TRAF2/TRAF6:IPS-1:RIP-1/FADD:Casp-8/10 prodomain:IKK complex [mitochondrial outer membrane] (REACT_27017), activated TLR4:TRAM:TRIF:K63-pUb-TRAF6:free K63-linked pUb:activated TAK1 complex [plasma membrane, cytosol] (REACT_26039), multiubiquitinated Skp2:phospho-APC/C:Cdh1 complex [cytosol] (REACT_9140), dsRNA:Ub-RIG-I:TRIM25 [cytosol] (REACT_26009), Poly-K6-Ub-hp-IRAK1 [cytosol] (REACT_23323), polyubiquitinated PAK-2p34 [cytosol] (REACT_13958), multi-ubiquitinated APOBEC3G:Vif:Cul5:SCF complex [cytosol] (REACT_9570), Rnf125:E2 enzyme (UBE2K, UbcH5a-c):K48-polyubiquitin [cytosol] (REACT_26254), EGF:Phospho-EGFR (Y1045) dimer:CBL:Phospho-Sprouty ubiquitinated [plasma membrane] (REACT_12687), viral dsRNA:TLR3:TRIF:pUb-TRAF6:TAB1:TAB2/TAB3:free polyubiquitin chain : phospho-TAK1 [endosome membrane] (REACT_7524), Ubiquitin:E2 conjugating enzymes [cytosol] (REACT_76303), E1 bound ubiquitin [cytosol] (REACT_76108), eRF3-GTP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_4059), dsRNA:RIG-I/MDA5:IPS-1:PCBP2 [mitochondrial outer membrane] (REACT_25961), p-IRAK2:K63-linked pUb oligo-TRAF6 [cytosol] (REACT_24859), ub-FANCD- and ub-FANCI-bound chromatin [nucleoplasm] (REACT_18703), p-IRAK2:K63-linked pUb oligo-TRAF6:free K63 pUb:TAK1 complex [plasma membrane, cytosol] (REACT_27027), dsRNA:RIG-1/MDA5:IPS-1:Ub-TRAF3:TBK1/IKKi [mitochondrial outer membrane] (REACT_26022), p-IRAK2:K63-linked pUb oligo-TRAF6:free K63-linked pUb:p-TAK1complex [plasma membrane, cytosol] (REACT_26622), Cool/Pix Ubiquitinated:CDC42-GTP [cytosol] (REACT_13061), Poly-ubiquitinated TRAF6 [cytosol] (REACT_13062), K63-poly-Ub TRAF6 [cytosol] (REACT_23147), EGF:Phospho-EGFR (Y1045) dimer Ubiquitinated:Phospho-CBL:GRB2 [plasma membrane] (REACT_12838), p-IRAK2:K63-linked pUb oligo-TRAF6:free K63-linked pUb:p-TAK1complex [endosome membrane, cytosol] (REACT_27039), Preproinsulin-SRP-SRP Receptor Complex [endoplasmic reticulum membrane, cytosol] (REACT_15837), RNF125:E2 enzyme (UBE2K, UbcH5a-c):K48-polyubiquitin [cytosol] (REACT_25756), K63-polyubiquitinated TRAF6 [endosome membrane] (REACT_21962), multiubiquitinated Cdh1 associated with APC/C [nucleoplasm] (REACT_7295), 80S:Met-tRNAi:mRNA [cytosol] (REACT_4537), hp-IRAK1:K6-polyUb TRAF6 [cytosol] (REACT_22716), dsRNA:RIG-I/MDA5:IPS-1:TRAF2/TRAF6:TANK [mitochondrial outer membrane] (REACT_27050), CIN85 ubiquitinated [cytosol] (REACT_13254), Viral dsRNA:TLR3:TRIF:pUb-TRAF6:TAK1:TAB1:TAB2/TAB3: free_pUb chain Complex [endosome membrane] (REACT_7699), ubiquitinated phospho-beta-catenin:SCF:beta-TrCP1 complex [cytosol] (REACT_10202), dsRNA:RIG-I/MDA5:TRAF2/TRAF6:IPS-1:RIP-1/FADD:Casp-8/10 prodomain [mitochondrial outer membrane] (REACT_26324), hp-IRAK1:K6-poly-Ub oligo-TRAF6:TAK1 complex [cytosol] (REACT_22797), ubiquitinated PAK-2p34 [cytosol] (REACT_14287), ubiquitinated Orc1 [nucleoplasm] (REACT_5402), K-63-linked polyubiquitin RIG-I [cytosol] (REACT_26331), pUb-TRAF6:TAB1:TAB2/TAB3:free polyubiquitin chain : phospho-TAK1 [cytosol] (REACT_23131), NGF ligand:p75NTR:Phospho-IRAK1:polyubiquitinated TRAF6:p62 [plasma membrane] (REACT_14488), dsRNA:RIG-I/MDA5:IPS-1:TRAF2/TRAF6:TANK:TBK1/IKKi [mitochondrial outer membrane] (REACT_25493), Cyclin E/A:Cdk2:multiubiquitinated phospho-p27/p21:SCF(Skp2):Cks1 complex [nucleoplasm] (REACT_9266), Preproinsulin-Translocon Complex [endoplasmic reticulum membrane, cytosol] (REACT_15661), SCF-associated multiubiquitinated Emi1complexes [cytosol] (REACT_7461), ESCRT-I/Cargo Complex [endosome membrane] (REACT_27922), dsRNA:RIG-1/MDA5:IPS-1:Ub-TRAF3 [mitochondrial outer membrane] (REACT_26564), mono-ubiquitinated FANCD2 [nucleoplasm] (REACT_18762), p-IRAK2:K63-linked pUb oligo-TRAF6 [plasma membrane] (REACT_26930), 80S Ribosome:mRNA Complex [cytosol] (REACT_21990), 80S ribosome [cytosol] (REACT_4330), 80S:Met-tRNAi:mRNA:eIF5B:GTP [cytosol] (REACT_2486), SMG1:UPF1:EJC:Translated mRNP [cytosol] (REACT_76647), Ag-substrate:E3:E2:Ub [cytosol] (REACT_76727), viral dsRNA : TLR3 : TRIF : pUb-TRAF6 [endosome membrane] (REACT_22052), 80S Ribosome:mRNA:peptidyl-tRNA with elongating peptide [cytosol] (REACT_4835), CIN85 ubiquitinated:Endophilin [cytosol] (REACT_12922), p-IRAK2:K63-linked pUb oligo-TRAF6:free K63-linked pUb:p-TAK1complex [cytosol] (REACT_24862), K63-linked polyUb - RIP1 [plasma membrane] (REACT_26236), mono-ubiquitinated FANCI [nucleoplasm] (REACT_18503), dsRNA:RIG-I/MDA5:IPS-1:RIP-1/FADD [mitochondrial outer membrane] (REACT_26077), IKK complex with Ub-NEMO [cytosol] (REACT_12853), Ubiquinated and PIP3 Endosmal Membrane Bound Cargo [endocytic vesicle membrane] (REACT_27362), ubiquitinated phospho-COP1(ser-387) [cytosol] (REACT_21146), multiubiquitinated Securin in complex with CDC20:phospho-APC/C [cytosol] (REACT_7079), Phospho-SPROUTY ubiquitinated [cytosol] (REACT_13220), multiubiquitinated Cyclin B:Cdc2:Cdc20:phospho-APC/C complex [cytosol] (REACT_7475), polyubiquitinated PAK-2p34 [cytosol] (REACT_14496), Preprolactin-SRP Complex [cytosol] (REACT_21159), geminin:ubiquitin complex [cytosol] (REACT_2422), 80S:aminoacyl tRNA:mRNA:eEF1A:GTP [cytosol] (REACT_5558), Ub-TRAF6 trimer bound to CBM complex [plasma membrane] (REACT_12752), Preproinsulin:Ribosome Nascent Complex (translocon associated) [cytosol, endoplasmic reticulum membrane] (REACT_20998), eRF3-GDP:eRF1:80S Ribosome:mRNA:tRNA Complex [cytosol] (REACT_4303), K63-linked polyUb p-IRAK1:TRAF6 [cytosol] (REACT_25933), SMG1:Phosphorylated UPF1:EJC:Translated mRNP [cytosol] (REACT_76156), dsRNA:RIG-I/MDA5:IPS-1:TRAF2/TRAF6:TANK:TBK1/IKKi:IRF7 [mitochondrial outer membrane] (REACT_26674), dsRNA:RIG-I/MDA5:IPS-1 [mitochondrial outer membrane] (REACT_26220), Preprolactin Ribosome Nascent Complex [cytosol] (REACT_24551), hp-IRAK1:K6 poly-Ub oligo-TRAF6 [cytosol] (REACT_23272), K63-linked polyUb p-IRAK1:TRAF6 [endosome membrane] (REACT_25541), dsRNA:RIG-I/MDA5:IPS-1:TRAF2/TRAF6 [mitochondrial outer membrane] (REACT_26067), ubiquitinated Orc1 [cytosol] (REACT_5173), multiubiquitinated Cyclin A associated with MCC:APC/C complex [cytosol] (REACT_7710), FYN-like kinases:p(Y731)-CBL:GRB2:Ubiquitinated p85-containing Class 1A PI3Ks [cytosol] (REACT_24386), 60S ribosomal complex [cytosol] (REACT_2629), ubiquitinated Cdc6 [cytosol] (REACT_5308), dsRNA:RIG-I/MDA5:IPS-1:ATG5-ATG12 [mitochondrial outer membrane] (REACT_26782), multi-ubiquitinated phospho-(T286) Cyclin D1 [cytosol] (REACT_7367), p-IRAK2:K63-linked pUb oligo-TRAF6:free K63 pUb:TAK1 complex [endosome membrane, cytosol] (REACT_26866), K-63 polyubiquitinated TRAF3 [cytosol] (REACT_26596), Poly-K6-Ub-hp-IRAK1:IKK complex [plasma membrane] (REACT_22624), K48-polyubiquitinated substrate [cytosol] (REACT_75986), EGF:Phospho-EGFR (Y1045) dimer Ubiquitinated:Phospho-CBL [plasma membrane] (REACT_12986), K63-poly-Ub TRAF6 [plasma membrane] (REACT_25539), ESCRT-II/Cargo Complex [endosome membrane] (REACT_27742), dsRNA:RIG-I/MDA5:K48 Ub-IPS-1 [mitochondrial outer membrane] (REACT_25887), Ubiquitinated phospho-IkB [cytosol] (REACT_14136), PAMP:NOD oligomer:K63-polyUb-RIP2:NEMO:TAK1 complex [cytosol, plasma membrane] (REACT_76707).

biological_process: S phase of mitotic cell cycle, G1/S transition of mitotic cell cycle, Toll signaling pathway, DNA repair, epidermal growth factor receptor signaling pathway, endosome transport, nucleotide-binding oligomerization domain containing signaling pathway, regulation of apoptosis, cellular protein metabolic process, cellular membrane organization, induction of apoptosis by extracellular signals, negative regulation of type I interferon production, toll-like receptor 4 signaling pathway, nerve growth factor receptor signaling pathway, RNA metabolic process, MyD88-dependent toll-like receptor signaling pathway, MyD88-independent toll-like receptor signaling pathway, activation of innate immune response, protein polyubiquitination, JNK cascade, toll-like receptor 2 signaling pathway, toll-like receptor signaling pathway, mRNA metabolic process, positive regulation of I-kappaB kinase/NF-kappaB cascade, M/G1 transition of mitotic cell cycle, anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process, DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest, positive regulation of NF-kappaB transcription factor activity, I-kappaB kinase/NF-kappaB cascade, activation of MAPK activity, toll-like receptor 3 signaling pathway, toll-like receptor 1 signaling pathway, negative regulation of epidermal growth factor receptor signaling pathway, regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle, positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle, negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle, antigen processing and presentation of peptide antigen via MHC class I, gene expression, T cell receptor signaling pathway, mitotic cell cycle, anti-apoptosis, innate immune response, apoptosis, stress-activated MAPK cascade, cell cycle checkpoint, viral reproduction, translational termination, translational elongation, translation.

These properties come from kegg analysis


KEGG_ORTHOLOGS: small subunit ribosomal protein S27Ae (K02977).

cellular_component: cytosolic small ribosomal subunit.

COG: Ribosomal protein S27AE (COG1998).

Locations

Located in CM3.5_scaffold00001 from 3823390 to 3824982.

This polypeptide in other databases

In PhylomeDB is Phy003MA0B_CUCME .

Related features