Polypeptide MELO3C002664P1
Accession: MELO3C002664P1
Name: MELO3C002664P1
Description: Similar to Nucleobase-ascorbate transporter 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q94C70|NAT2_ARATH)
Sequence:
>MELO3C002664P1 Similar to Nucleobase-ascorbate transporter 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q94C70|NAT2_ARATH) MEAPKPEEISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGDDGDKVRVVQTLLFVEGIN TLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLSRIEDPHLRFLNTMRAVQGALIVSSSIQIILGYSQLWAICSRFFSP LGMVPVIALVGFGLFDRGFPVVGRCVEIGVPMLILFIAFSQYLKGFHTRQLPILERFALLITVTVIWAYAHLLTASGAYK HRPELTQMNCRTDRANLISSAPWIKIPYPLQWGAPTFNAGHAFGMMAAVLVSLVESTGAFKAASRLASATPPPAHVLSRG IGWQGIGILLSGLFGTLSGSTVSIENVGLLGSTRVGSRRVIQISAGFMIFFSILGKFGALFASIPFTIFAAVYCVLFGLV ASVGLSFLQFTNMNSMRNLFITGVALYLGLSVPDYFREYTAKAFHGPAHTNAGWFNDFLNTIFFSPPTVALIVAVFLDNT LDYKDSARDRGMPWWVKFRTFKGDSRNEEFYTLPFNLNRFFPPS*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Ascorbate transport across the plasma membrane (REACT_98551), Ascorbate transport across the plasma membrane (REACT_89713).
biological_process: vitamin metabolic process, water-soluble vitamin metabolic process.
REACTOME_PATHWAY: Vitamin C (ascorbate) metabolism (REACT_81365), Metabolism of vitamins and cofactors (REACT_30091), Metabolism of vitamins and cofactors (REACT_83508), Metabolism of water-soluble vitamins and cofactors (REACT_86005), Vitamin C (ascorbate) metabolism (REACT_108458), Metabolism of water-soluble vitamins and cofactors (REACT_107096).
These properties come from phylome analysis
molecular_function: transporter activity.
cellular_component: integral to membrane, membrane.
biological_process: transmembrane transport.
These properties come from blast2go analysis
molecular_function: transmembrane transporter activity.
cellular_component: membrane.
biological_process: transmembrane transport.
This polypeptide in other databases
In PhylomeDB is Phy003A5M6_CUCME .

