Polypeptide MELO3C002676P1
Accession: MELO3C002676P1
Name: MELO3C002676P1
Description: Similar to Ras-related protein RABA1c (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FK68|RAA1C_ARATH)
Sequence:
>MELO3C002676P1 Similar to Ras-related protein RABA1c (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FK68|RAA1C_ARATH) MAGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLNVDGKVVKAQIWDTAGQERYRAITS AYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLVGNKSDLRHLVAVSTEDGKSFAEKESLYFMETSALEA TNVENSFAEVLTQIYHIVSKKAMEAGDGTAAASVPPKGEKIDVSKDVSAVKKAGCCSS*
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_ORTHOLOGS: Rab family, other (K07976).
These properties come from phylome analysis
molecular_function: hydrolase activity, GTP binding.
cellular_component: trans-Golgi network membrane, early endosome membrane, plasma membrane.
biological_process: protein transport, small GTPase mediated signal transduction.
These properties come from blast2go analysis
molecular_function: hydrolase activity, GTP binding, DNA binding.
cellular_component: plasma membrane, vacuole, nucleus.
biological_process: protein transport, small GTPase mediated signal transduction.
This polypeptide in other databases
In PhylomeDB is Phy003AD2Y_CUCME .

