Polypeptide MELO3C002712P1

Accession: MELO3C002712P1

Name: MELO3C002712P1

Description: Similar to Coatomer subunit zeta-1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q940S5|COPZ1_ARATH)

Sequence:

>MELO3C002712P1 Similar to Coatomer subunit zeta-1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q940S5|COPZ1_ARATH)
MESCPSIKNILLLDSEGKRVAVKYYSDDWPTNSTKEAFEKAVFIKTQKTNARTEAEIAMFENNIVVYKFAQDLHFFVTGG
EDENELILASVLQGFFDAVGILLRGNVEKKEALENLDLILLCLDEIIDGGIILETDANVIAGKVASHSIDSNAPLSEQTI
SQALATAREHLARSLLK*

Download fasta sequence.

Properties

These properties come from reactome analysis

REACTOME_REACTION: GAP Recruitment to the Coatomer:Arf1-GTP Complex (REACT_96165), Coat Complex Formation (REACT_11243), GAP Recruitment to the Coatomer:Arf1-GTP Complex (REACT_11111), Sculpting and pinching-off of Golgi vessicle (REACT_87018), Sculpting and pinching-off of Golgi vessicle (REACT_93467), Coat Complex Formation (REACT_110599), Sculpting and pinching-off of Golgi vessicle (REACT_98942), Coat Complex Formation (REACT_80819), Coat Complex Formation (REACT_106687), Coat Complex Formation (REACT_99497), Sculpting and pinching-off of Golgi vessicle (REACT_11138), GAP Recruitment to the Coatomer:Arf1-GTP Complex (REACT_109267), Sculpting and pinching-off of Golgi vessicle (REACT_83563).

biological_process: COPI coating of Golgi vesicle, cellular membrane organization, retrograde vesicle-mediated transport, Golgi to ER.

REACTOME_COMPLEX: Coatomer:Arf1-GDP:GAP Complex [Golgi membrane] (REACT_11510), Coatomer:Arf1-GTP Complex [Golgi membrane] (REACT_11791), Coatomer:GAP Complex [Golgi membrane] (REACT_11710), Coatomer [cytosol] (REACT_11329), Coatomer:GAP Complex [Golgi-associated vesicle membrane] (REACT_11857), Coatomer:Arf1-GTP:GAP Complex [Golgi membrane] (REACT_11350).

REACTOME_PATHWAY: Membrane Trafficking (REACT_86557), Membrane Trafficking (REACT_11123), Golgi to ER Retrograde Transport (REACT_11208), Membrane Trafficking (REACT_83546), COPI Mediated Transport (REACT_85460), Golgi to ER Retrograde Transport (REACT_88525), Golgi to ER Retrograde Transport (REACT_106254), COPI Mediated Transport (REACT_33101), Golgi to ER Retrograde Transport (REACT_101581), Membrane Trafficking (REACT_91154), Golgi to ER Retrograde Transport (REACT_107028), COPI Mediated Transport (REACT_28932), Membrane Trafficking (REACT_34084), COPI Mediated Transport (REACT_97338), COPI Mediated Transport (REACT_11096).

These properties come from phylome analysis

biological_process: transport.

These properties come from blast2go analysis

cellular_component: clathrin vesicle coat, viral capsid.

biological_process: transport.

Locations

Located in CM3.5_scaffold00001 from 5782848 to 5785971.

This polypeptide in other databases

In PhylomeDB is Phy003MB64_CUCME .

Related features