Polypeptide MELO3C002717P1
Accession: MELO3C002717P1
Name: MELO3C002717P1
Description: Similar to Prefoldin subunit 6 (Mus musculus) (uniprot_sprot:sp|Q03958|PFD6_MOUSE)
Sequence:
>MELO3C002717P1 Similar to Prefoldin subunit 6 (Mus musculus) (uniprot_sprot:sp|Q03958|PFD6_MOUSE) MSSTSALRELQRELEAKANDLSKLQKDIAKNHQVRKKYTVQLGENELVLKELDLLQDDTNVYKLIGPVLVKQDLAEANAN VRKRIEYISAELKRLDSALQDLEEKQNSNRDAILKLQQRIQSLQAGKAKA*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: unfolded protein binding.
cellular_component: prefoldin complex, cytoplasmic membrane-bounded vesicle.
biological_process: protein folding.
These properties come from reactome analysis
REACTOME_REACTION: unfolded actin/tubulin associates with prefoldin (REACT_16892), unfolded actin/tubulin associates with prefoldin (REACT_29326), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_79699), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_82740), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_16961), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_91786), unfolded actin/tubulin associates with prefoldin (REACT_94084), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_109317), unfolded actin/tubulin associates with prefoldin (REACT_82152).
biological_process: cellular protein metabolic process, 'de novo' posttranslational protein folding, protein folding.
REACTOME_COMPLEX: Prefoldin-associated actin/tubulin [cytosol] (REACT_18141), Prefoldin [cytosol] (REACT_17255).
REACTOME_PATHWAY: Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_94344), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_16936), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_78563), Protein folding (REACT_16952), Chaperonin-mediated protein folding (REACT_104912), Protein folding (REACT_90475), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_93325), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_87227), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_17029), Chaperonin-mediated protein folding (REACT_17004), Metabolism of proteins (REACT_91052), Protein folding (REACT_100416), Chaperonin-mediated protein folding (REACT_100411), Metabolism of proteins (REACT_85873), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_91371), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_34237), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_80983), Metabolism of proteins (REACT_86658), Protein folding (REACT_85464), Metabolism of proteins (REACT_17015), Chaperonin-mediated protein folding (REACT_106927), Chaperonin-mediated protein folding (REACT_32155), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_81425), Metabolism of proteins (REACT_102155), Protein folding (REACT_30135).
These properties come from phylome analysis
molecular_function: chaperone binding, tubulin binding, unfolded protein binding.
cellular_component: nucleus, prefoldin complex.
biological_process: chaperone-mediated protein complex assembly, 'de novo' posttranslational protein folding, cortical microtubule organization, inductive cell migration, hermaphrodite genitalia development, positive regulation of growth rate, growth, body morphogenesis, embryo development ending in birth or egg hatching, tubulin complex assembly, receptor-mediated endocytosis, nematode larval development, protein folding.
These properties come from kegg analysis
KEGG_ORTHOLOGS: prefoldin beta subunit (K04798).
COG: Prefoldin, chaperonin cofactor (COG1382).
This polypeptide in other databases
In PhylomeDB is Phy003AC4X_CUCME .
