Polypeptide MELO3C002878P1

Accession: MELO3C002878P1

Name: MELO3C002878P1

Description: Similar to Elongation factor 1-alpha (Manihot esculenta) (uniprot_sprot:sp|O49169|EF1A_MANES)

Sequence:

>MELO3C002878P1 Similar to Elongation factor 1-alpha (Manihot esculenta) (uniprot_sprot:sp|O49169|EF1A_MANES)
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI
IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA
VRDMRQTVAVGVIKAVEKKDASGAKVTKSAAKKSGK*

Download fasta sequence.

Properties

These properties come from reactome analysis

REACTOME_REACTION: Regeneration of eEF1A:GTP by eEF1B activity (REACT_101345), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_31671), Hydrolysis of eEF1A:GTP (REACT_108111), eEF1A:GTP:aminoacyl tRNA ternary complex formation. (REACT_86783), eEF1A complexes with GTP (REACT_98519).

biological_process: translation, gene expression, cellular protein metabolic process, translational elongation.

REACTOME_PATHWAY: Gene Expression (REACT_85241), Metabolism of proteins (REACT_99179), Translation (REACT_86996), Eukaryotic Translation Elongation (REACT_93503), Peptide chain elongation (REACT_106978).

These properties come from blast2go analysis

molecular_function: GTP binding, sulfate adenylyltransferase (ATP) activity, GTPase activity, translation elongation factor activity.

cellular_component: cytoplasm.

biological_process: translational elongation.

Locations

Located in CM3.5_scaffold01595 from 148836 to 151697.

This polypeptide in other databases

In PhylomeDB is Phy003LKMY_CUCME .

Related features