Polypeptide MELO3C002888P1

Accession: MELO3C002888P1

Name: MELO3C002888P1

Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_19.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7TMC3)

Sequence:

>MELO3C002888P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_19.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7TMC3)
MKPHDQNLERYGKLCRERTHKSMTKSRQIQVIDHVTGGHMRPMPGMDVLSFGAAEKKKVVSKGSETKRLRKERGELEKII
FKLFERQPYWTSKQLIQETDQPEQYMKEILKDLCVYNNKGVHQGTYELKPEYKESSEETKPR*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: RNA polymerase II transcription factor activity, translation initiation factor activity, catalytic activity, ATP binding.

cellular_component: transcription factor TFIIF complex, mitochondrion.

biological_process: transcription initiation from RNA polymerase II promoter.

These properties come from reactome analysis


REACTOME_PATHWAY: RNA Polymerase II Transcription (REACT_99228), mRNA Splicing (REACT_94469), Formation of the Early Elongation Complex (REACT_101279), mRNA Capping (REACT_102770), mRNA Splicing - Major Pathway (REACT_91611), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_1655), RNA Pol II CTD phosphorylation and interaction with CE (REACT_96584), Elongation arrest and recovery (REACT_1892), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_78187), Pausing and recovery of Tat-mediated HIV-1 elongation (REACT_6143), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_34355), RNA Pol II CTD phosphorylation and interaction with CE (REACT_90040), Abortive elongation of HIV-1 transcript in the absence of Tat (REACT_6261), mRNA Capping (REACT_85081), RNA Polymerase II HIV-1 Promoter Escape (REACT_6253), Formation of the Early Elongation Complex (REACT_846), RNA Polymerase II Transcription Elongation (REACT_87946), HIV-1 elongation arrest and recovery (REACT_6259), Formation of HIV-1 elongation complex in the absence of HIV-1 Tat (REACT_22201), Pausing and recovery of elongation (REACT_769), Transcription (REACT_1788), Gene Expression (REACT_85241), mRNA Capping (REACT_1470), mRNA Capping (REACT_85562), Processing of Capped Intron-Containing Pre-mRNA (REACT_29012), RNA Pol II CTD phosphorylation and interaction with CE (REACT_30624), RNA Polymerase II Pre-transcription Events (REACT_82727), Formation of the HIV-1 Early Elongation Complex (REACT_6319), Pausing and recovery of HIV-1 elongation (REACT_6244), RNA Polymerase II Promoter Escape (REACT_81662), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_109232), mRNA Splicing - Major Pathway (REACT_93740), mRNA Splicing (REACT_107931), RNA Pol II CTD phosphorylation and interaction with CE (REACT_33716), RNA Polymerase II Transcription Elongation (REACT_81750), RNA Polymerase II Promoter Escape (REACT_107789), mRNA Splicing - Minor Pathway (REACT_101749), RNA Polymerase II Transcription Elongation (REACT_92836), RNA Polymerase II Transcription (REACT_1366), Elongation arrest and recovery (REACT_91132), RNA Polymerase II Pre-transcription Events (REACT_91707), RNA Polymerase II Transcription Elongation (REACT_94090), mRNA Splicing (REACT_81581), mRNA Processing (REACT_1675), Formation of RNA Pol II elongation complex (REACT_1845), Transcription of the HIV genome (REACT_6233), RNA Pol II CTD phosphorylation and interaction with CE (REACT_6237), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_87559), HIV-1 Transcription Initiation (REACT_6332), RNA Pol II CTD phosphorylation and interaction with CE (REACT_975), RNA Polymerase II Promoter Escape (REACT_106149), mRNA Processing (REACT_80866), Formation and Maturation of mRNA Transcript (REACT_32779), Formation of the Early Elongation Complex (REACT_97522), RNA Polymerase II Promoter Escape (REACT_2089), mRNA Splicing - Minor Pathway (REACT_1753), HIV Infection (REACT_6185), RNA Polymerase II Transcription Initiation (REACT_1851), Gene Expression (REACT_108313), RNA Polymerase II Pre-transcription Events (REACT_22107), Transcription (REACT_34268), Pausing and recovery of elongation (REACT_83577), Formation of HIV-1 elongation complex containing HIV-1 Tat (REACT_6346), Gene Expression (REACT_98256), mRNA Splicing - Minor Pathway (REACT_88186), Elongation arrest and recovery (REACT_79615), mRNA Splicing (REACT_1735), RNA Polymerase II Transcription Initiation (REACT_105389), Gene Expression (REACT_71), Tat-mediated HIV-1 elongation arrest and recovery (REACT_6344), mRNA Splicing - Minor Pathway (REACT_101135), Transcription (REACT_100899), Transcription (REACT_87991), mRNA Capping (REACT_81603), Processing of Capped Intron-Containing Pre-mRNA (REACT_30593), mRNA Processing (REACT_29019), RNA Polymerase II Transcription (REACT_99950), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_28862), Formation and Maturation of mRNA Transcript (REACT_77979), Late Phase of HIV Life Cycle (REACT_6361), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_79444), Gene Expression (REACT_105649), RNA Polymerase II Transcription (REACT_89454), Processing of Capped Intron-Containing Pre-mRNA (REACT_82582), HIV Life Cycle (REACT_6256), Formation of the Early Elongation Complex (REACT_99528), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_34737), Transcription (REACT_99758), RNA Polymerase II Pre-transcription Events (REACT_82104), Processing of Capped Intron-Containing Pre-mRNA (REACT_125), RNA Polymerase II Pre-transcription Events (REACT_91410), RNA Polymerase II Transcription Initiation (REACT_87429), Tat-mediated elongation of the HIV-1 transcript (REACT_6162), Formation and Maturation of mRNA Transcript (REACT_2039), RNA Polymerase II Transcription (REACT_106213), RNA Polymerase II Promoter Escape (REACT_109274), RNA Polymerase II Transcription Elongation (REACT_833), RNA Polymerase II Transcription Initiation (REACT_104036), HIV-1 Transcription Elongation (REACT_6274), mRNA Processing (REACT_90209), mRNA Splicing - Major Pathway (REACT_467), Pausing and recovery of elongation (REACT_111024), Formation and Maturation of mRNA Transcript (REACT_96378), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_83749), Formation and Maturation of mRNA Transcript (REACT_85219), RNA Polymerase II Transcription Initiation (REACT_104646), Formation of the Early Elongation Complex (REACT_84349), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_834), mRNA Processing (REACT_94551), Processing of Capped Intron-Containing Pre-mRNA (REACT_31128).

REACTOME_REACTION: RNA Polymerase II Promoter Opening: First Transition (REACT_29850), RNA Polymerase II Promoter Opening: First Transition (REACT_93391), Pol II elongation complex moves on the template as transcript elongates (REACT_30284), Formation of AT-AC B Complex (REACT_1253), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_1251), Formation of the Spliceosomal B Complex (REACT_48), Abortive Initiation After Second Transition (REACT_1793), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_84917), Abortive initiation after formation of the first phosphodiester bond (REACT_32630), Internal Methylation of mRNA (REACT_30916), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_77961), Formation of the closed pre-initiation complex (REACT_82855), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_1467), Phosphorylation (Ser5) of RNA pol II CTD (REACT_88766), Abortive HIV-1 Initiation Before Second Transition (REACT_6203), Internal Methylation of mRNA (REACT_1720), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_1082), Phosphorylation (Ser5) of RNA pol II CTD (REACT_90675), Pol II elongation complex moves on the template as transcript elongates (REACT_2053), Abortive initiation after formation of the first phosphodiester bond (REACT_653), Fall Back to Closed Pre-initiation Complex (REACT_6211), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_1494), Abortive termination of HIV-1 elongation after arrest (Tat-containing elongation complex) (REACT_6269), Formation of the CE:GMP intermediate complex (REACT_79193), Activation of GT (REACT_103913), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_79829), Abortive HIV-1 Initiation After Second Transition (REACT_6265), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_2233), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_95548), Extrusion of 5-end of 30 nt long HIV-1 transcript through the pore in Pol II complex (REACT_6148), TFIIS-mediated recovery of HIV-1 elongation from arrest (REACT_6252), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_6250), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_85925), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6254), RNA Polymerase II Promoter Opening: First Transition (REACT_94679), Abortive termination of early transcription elongation by DSIF:NELF (REACT_89590), Formation of the CE:GMP intermediate complex (REACT_90910), Dissociation of transcript with 5-GMP from GT (REACT_87469), Abortive Initiation Before Second Transition (REACT_106763), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_83079), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_94470), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_802), NTP Binds Active Site of RNA Polymerase II (REACT_84849), Methylation of GMP-cap by RNA Methyltransferase (REACT_404), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_29457), TFIIS-mediated recovery of elongation from arrest (REACT_1094), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_1968), Separation of abortive HIV-1 transcript from template (REACT_6159), Pol II elongation complex moves on the HIV-1 template as transcript elongates (REACT_6158), Phosphorylation of NEFL by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6311), Phosphorylation of DSIF by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6316), Dissociation of transcript with 5-GMP from GT (REACT_30543), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_95240), Binding of TFIIE to the growing preinitiation complex (REACT_82447), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6155), Resumption of elongation after recovery from pausing (REACT_79713), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_103685), Formation of the closed pre-initiation complex (REACT_83351), Pol II elongation complex moves on the template as transcript elongates (REACT_30038), Addition of nucleotides between position +11 and +30 on HIV-1 transcript (REACT_6240), Dissociation of transcript with 5-GMP from GT (REACT_101219), Methylation of GMP-cap by RNA Methyltransferase (REACT_96650), Capping complex formation (REACT_32400), Addition of nucleotides leads to transcript elongation (REACT_107064), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_97660), Resumption of elongation after recovery from pausing (REACT_99936), NTP Binds Active Site of RNA Polymerase II (REACT_86985), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_81068), Activation of GT (REACT_96305), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_1567), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_234), Formation of Exon Junction Complex (REACT_92827), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_86649), Formation of pre-mRNPs (REACT_1877), Fall Back to Closed Pre-initiation Complex (REACT_1702), Addition of nucleotides between position +11 and +30 (REACT_77879), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_78922), Fall Back to Closed Pre-initiation Complex (REACT_92728), TFIIS-mediated recovery of elongation from arrest (REACT_101748), Formation of the closed pre-initiation complex (REACT_632), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_100344), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_1368), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_1684), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_33423), Formation of the CE:GMP intermediate complex (REACT_1580), Dissociation of transcript with 5-GMP from GT (REACT_90647), NTP Binds Active Site of RNA Polymerase II (REACT_80520), Addition of nucleotides between position +11 and +30 (REACT_29713), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28433), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_110194), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_581), Formation of AT-AC C complex (REACT_110048), Capping complex formation (REACT_85029), Formation of the Spliceosomal E complex (REACT_222), Formation of AT-AC C complex (REACT_78819), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_423), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28192), Fall Back to Closed Pre-initiation Complex (REACT_86577), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_32792), RNA Polymerase II Promoter Opening: First Transition (REACT_1844), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_99814), Formation of DSIF:NELF:early elongation complex (REACT_96991), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_77594), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_30549), Formation of an intermediate Spliceosomal C complex (REACT_108009), Abortive Initiation After Second Transition (REACT_108713), Phosphorylation (Ser5) of RNA pol II CTD (REACT_6234), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_2066), TFIIS-mediated recovery of elongation from arrest (REACT_6330), Newly formed phosphodiester bond stabilized and PPi released (REACT_6333), HIV-1 Promoter Opening: First Transition (REACT_6134), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_102861), Abortive termination of elongation after arrest (REACT_95584), RNA Polymerase II Promoter Opening: First Transition (REACT_89694), Formation of the closed pre-initiation complex (REACT_105039), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_81891), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_103086), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_1055), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_88439), Activation of GT (REACT_893), Internal Methylation of mRNA (REACT_85125), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_77279), Capping complex formation (REACT_86608), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_2241), Formation of AT-AC B Complex (REACT_100957), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_103482), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_93340), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_87062), Fall Back to Closed Pre-initiation Complex (REACT_31744), NTP Binds Active Site of RNA Polymerase II (REACT_1160), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_109877), Addition of nucleotides leads to transcript elongation (REACT_751), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_6220), NTP binds active site of RNA Polymerase II in HIV-1 open pre-initiation complex (REACT_6349), Formation of the CE:GMP intermediate complex (REACT_110689), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_34550), Addition of nucleotides between position +11 and +30 (REACT_28970), Formation of AT-AC A complex (REACT_864), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6347), Recruitment of elongation factors to form elongation complex (REACT_949), Lariat Formation and 5-Splice Site Cleavage (REACT_82009), Abortive HIV-1 initiation after formation of the first phosphodiester bond (REACT_6226), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_83561), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_93916), Methylation of GMP-cap by RNA Methyltransferase (REACT_34170), Activation of GT (REACT_6298), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6299), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_6297), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_105023), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_6295), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_99299), Activation of GT (REACT_103525), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_79518), Recognition and binding of the mRNA cap by the cap-binding complex (REACT_687), Addition of nucleotides between position +11 and +30 (REACT_209), Activation of GT (REACT_84234), Limited elongation of the HIV-1 transcript (REACT_6192), Abortive termination of HIV-1 early transcription elongation by DSIF:NELF (REACT_6281), Formation of AT-AC C complex (REACT_1615), Lariat Formation and 5-Splice Site Cleavage (REACT_1935), Binding of TFIIE to the growing preinitiation complex (REACT_78942), NTP Binds Active Site of RNA Polymerase II (REACT_80120), Capping complex formation (REACT_77633), Formation of AT-AC B Complex (REACT_101559), Formation of the Spliceosomal B Complex (REACT_90182), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6214), Binding of TFIIE to the growing preinitiation complex (REACT_1821), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_29917), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6358), Formation of DSIF:NELF:HIV-1 early elongation complex (REACT_6357), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_29379), Abortive termination of elongation after arrest (REACT_6355), Abortive termination of HIV-1 elongation after arrest (REACT_6352), Abortive Initiation After Second Transition (REACT_103184), Cleavage at the 3-Splice Site and Exon Ligation (REACT_1331), Abortive Initiation After Second Transition (REACT_103180), Methylation of GMP-cap by RNA Methyltransferase (REACT_93915), Addition of nucleotides leads to transcript elongation (REACT_100466), TFIIS-mediated recovery of elongation from arrest (REACT_102520), Separation of elongating transcript from template (REACT_81515), Capping complex formation (REACT_2186), Formation of Exon Junction Complex (REACT_85923), Formation of the active Spliceosomal C complex (REACT_63591), Nucleophillic attack by 3-hydroxyl oxygen of nascent HIV-1 transcript on the Alpha phosphate of NTP (REACT_6285), Formation of the CE:GMP intermediate complex (REACT_92552), Elongating transcript encounters a lesion in the template (REACT_1138), Formation of an intermediate Spliceosomal C complex (REACT_91565), Abortive termination of early transcription elongation by DSIF:NELF (REACT_87802), Binding of TFIIE to the growing preinitiation complex (REACT_32367), Phosphorylation (Ser5) of RNA pol II CTD (REACT_77857), Formation of AT-AC B Complex (REACT_90655), Phosphorylation (Ser5) of RNA pol II CTD (REACT_1185), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_34583), Formation of the active Spliceosomal C complex (REACT_89446), Abortive termination of elongation after arrest (REACT_98053), Formation of Exon Junction Complex (REACT_774), Addition of nucleotides 10 and 11 on the growing HIV-1 transcript: Third Transition (REACT_6208), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_92765), Recognition and binding of the HIV-1 mRNA cap by the cap-binding complex (REACT_6166), Phosphorylation (Ser5) of RNA pol II CTD (REACT_91157), Internal Methylation of mRNA (REACT_101890), Formation of the closed pre-initiation complex (REACT_98407), Separation of elongating transcript from template (REACT_2030), Separation of elongating HIV-1 transcript from template (REACT_6204), Fall Back to Closed Pre-initiation Complex (REACT_100253), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_6206), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_110236), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_86674), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_105022), Formation of the Spliceosomal B Complex (REACT_109266), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_30335), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_103987), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_33504), Abortive termination of early transcription elongation by DSIF:NELF (REACT_989), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_88434), Formation of the active Spliceosomal C complex (REACT_1554), Formation of AT-AC C complex (REACT_95722), Formation of an intermediate Spliceosomal C complex (REACT_625), Formation of DSIF:NELF:early elongation complex (REACT_981), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_29681), 7-14 nt. Backtracking of Pol II complex on the template leading to elongation arrest (REACT_1645), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_81731), Lariat Formation and 5-Splice Site Cleavage (REACT_28087), Resumption of elongation after recovery from pausing (REACT_1638), Separation of elongating transcript from template (REACT_34213), Formation of the Spliceosomal A Complex (REACT_788), Addition of nucleotides between position +11 and +30 (REACT_90076), Addition of nucleotides 5 through 9 on the growing HIV-1 transcript (REACT_6172), Hyperphosphorylation (Ser2) of RNA Pol II CTD by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6170), Addition of nucleotides leads to HIV-1 transcript elongation (REACT_6278), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6174), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6275), Abortive Initiation Before Second Transition (REACT_543), Dissociation of transcript with 5-GMP from GT (REACT_703).

REACTOME_COMPLEX: HIV-1 Tat-containing paused processive elongation complex [nucleoplasm] (REACT_6389), RNA Polymerase II (unphosphorylated):TFIIF complex [nucleoplasm] (REACT_2692), Capping complex (intermediate) [nucleoplasm] (REACT_3580), Pol II Promoter Escape Complex [nucleoplasm] (REACT_3851), Capping complex (hydrolyzed) [nucleoplasm] (REACT_4969), HIV-1 transcription complex containing 11 nucleotide long transcript [nucleoplasm] (REACT_6664), Pol II transcription complex with (ser5) phosphorylated CTD containing extruded transcript to +30 [nucleoplasm] (REACT_2595), RNA Pol II with phosphorylated CTD: CE complex with activated GT [nucleoplasm] (REACT_3171), HIV-1 closed pre-initiation complex [nucleoplasm] (REACT_6553), Arrested processive elongation complex [nucleoplasm] (REACT_4675), Spliceosomal Intermediate C Complex [nucleoplasm] (REACT_5473), RNA Pol II (hypophosphorylated):capped pre-mRNA complex [nucleoplasm] (REACT_6382), pol II transcription complex containing 11 nucleotide long transcript [nucleoplasm] (REACT_3183), RNA Pol II with phosphorylated CTD: CE complex [nucleoplasm] (REACT_6521), HIV-1 Promoter Escape Complex [nucleoplasm] (REACT_6417), RNA Pol II with phosphorylated CTD: CE complex with activated GT [nucleoplasm] (REACT_6659), Spliceosomal Active C Complex [nucleoplasm] (REACT_2680), Aborted elongation complex after arrest [nucleoplasm] (REACT_6654), RNA Pol II with phosphorylated CTD: CE complex [nucleoplasm] (REACT_2371), Spliceosomal A Complex [nucleoplasm] (REACT_4512), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD and phospho-NELF [nucleoplasm] (REACT_6495), CE:Pol II CTD:Spt5 complex [nucleoplasm] (REACT_6491), Spliceosomal B Complex [nucleoplasm] (REACT_3078), Capping complex (with freed 5- GMP) [nucleoplasm] (REACT_4741), Elongation complex prior to separation [nucleoplasm] (REACT_5853), HIV-1 Tat-containing arrested processive elongation complex [nucleoplasm] (REACT_6532), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_6536), Elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_5512), DSIF:NELF:early elongation complex after limited nucleotide addition [nucleoplasm] (REACT_6432), HIV-1 transcription complex [nucleoplasm] (REACT_6433), pol II transcription complex containing 9 nucleotide long transcript [nucleoplasm] (REACT_5212), Processive elongation complex [nucleoplasm] (REACT_3018), Spliceosomal active C complex with lariat containing, 5-end cleaved pre-mRNP:CBC complex [nucleoplasm] (REACT_5191), Aborted early elongation complex [nucleoplasm] (REACT_3362), RNA polymerase II (phosphorylated):TFIIF complex [nucleoplasm] (REACT_4593), capped pre-mRNA:CBC:RNA Pol II (phosphorylated) complex [nucleoplasm] (REACT_3243), HIV-1 Polymerase II (phosphorylated):TFIIF:capped pre-mRNA [nucleoplasm] (REACT_6503), HIV-1 elongation complex [nucleoplasm] (REACT_6501), Pol II Initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_2410), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_6426), ATAC C Complex with lariat containing 5-end cleaved mRNA [nucleoplasm] (REACT_5134), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD ( phospho-NELF phospho DSIF) [nucleoplasm] (REACT_6633), HIV-1 transcription complex with (ser5) phosphorylated CTD containing extruded transcript to +30 [nucleoplasm] (REACT_6638), Capping complex (GpppN..) [nucleoplasm] (REACT_2312), Covalent CE:GMP intermediate complex [nucleoplasm] (REACT_2774), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex [nucleoplasm] (REACT_2469), pol II transcription complex containing 3 Nucleotide long transcript [nucleoplasm] (REACT_3251), HIV-1 transcription complex containing 3 nucleotide long transcript [nucleoplasm] (REACT_6450), HIV-1 initiation complex [nucleoplasm] (REACT_6518), HIV-1 Tat-containing processive elongation complex [nucleoplasm] (REACT_6452), HIV-1 paused processive elongation complex [nucleoplasm] (REACT_6459), HIV-1 transcription complex containing transcript to +30 [nucleoplasm] (REACT_6514), HIV-1 transcription complex containing extruded transcript to +30 [nucleoplasm] (REACT_6516), pol II transcription complex [nucleoplasm] (REACT_2954), Spliceosomal E Complex [nucleoplasm] (REACT_4545), Tat-containing elongation complex prior to separation [nucleoplasm] (REACT_6548), ATAC A Complex [nucleoplasm] (REACT_4037), pol II closed pre-initiation complex [nucleoplasm] (REACT_5734), pol II transcription complex containing 4-9 nucleotide long transcript [nucleoplasm] (REACT_3928), Aborted HIV-1 early elongation complex [nucleoplasm] (REACT_6695), HIV-1 transcription complex containing 9 nucleotide long transcript [nucleoplasm] (REACT_6561), HIV-1 transcription complex containing 4-9 nucleotide long transcript [nucleoplasm] (REACT_6563), Capping complex (initial) [nucleoplasm] (REACT_4555), HIV-1 elongation complex containing Tat [nucleoplasm] (REACT_6611), Pol II initiation complex [nucleoplasm] (REACT_5487), Early elongation complex with separated aborted transcript [nucleoplasm] (REACT_6590), Pol II transcription complex containing extruded transcript to +30 [nucleoplasm] (REACT_4335), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_6594), TFIIF [nucleoplasm] (REACT_4708), HIV-1 transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_6640), Early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_2481), pol II open pre-initiation complex [nucleoplasm] (REACT_4930), ATAC C Complex [nucleoplasm] (REACT_4626), P-TEFb(Cyclin T1:Cdk9)-containing elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_6686), HIV-1 initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_6680), HIV-1 processive elongation complex [nucleoplasm] (REACT_6579), HIV-1 aborted elongation complex after arrest [nucleoplasm] (REACT_6471), post exon ligation complex [nucleoplasm] (REACT_5793), RNA Polymerase II (phosphorylated):TFIIF:capped pre-mRNA [nucleoplasm] (REACT_3935), HIV-1 arrested processive elongation complex [nucleoplasm] (REACT_6609), HIV-1 open pre-initiation complex [nucleoplasm] (REACT_6605), Pol II transcription complex containing transcript to +30 [nucleoplasm] (REACT_4399), HIV-1 Tat-containing aborted elongation complex after arrest [nucleoplasm] (REACT_6602), capped, methylated pre-mRNA:CBC Complex [nucleoplasm] (REACT_3634), ATAC B Complex [nucleoplasm] (REACT_5095), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_4417), CE:Pol II CTD:Spt5 complex [nucleoplasm] (REACT_2332), pol II transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_4148), RNA Polymearse II:NTP:TFIIF complex [nucleoplasm] (REACT_4655), RNA Pol II (hypophosphorylated):capped pre-mRNA complex [nucleoplasm] (REACT_5658), HIV-1 capped pre-mRNA:CBC:RNA Pol II (phosphorylated) complex [nucleoplasm] (REACT_6374), HIV-1 promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex* [nucleoplasm] (REACT_6371), RNA Polymerase II holoenzyme complex (hyperphosphorylated):TFIIF complex [nucleoplasm] (REACT_3841), HIV-1 early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_6467), Paused processive elongation complex [nucleoplasm] (REACT_3066), Exon Junction Complex [nucleoplasm] (REACT_2984), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_4575), Elongation complex [nucleoplasm] (REACT_3511), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF:TFIIE complex [nucleoplasm] (REACT_4404), capped, methylated pre-mRNP:CBC complex [nucleoplasm] (REACT_2736), RNA Polymerase II holoenzyme complex (hypophosphorylated):TFIIF complex [nucleoplasm] (REACT_5870).

biological_process: transcription initiation from RNA polymerase II promoter, gene expression, nuclear mRNA splicing, via spliceosome, viral transcription, mRNA capping, transcription from RNA polymerase II promoter, transcription elongation from RNA polymerase II promoter, positive regulation of viral transcription, RNA splicing, viral reproduction.

These properties come from phylome analysis


molecular_function: RNA polymerase II transcription factor activity, translation initiation factor activity, catalytic activity, ATP binding.

cellular_component: transcription factor TFIIF complex.

biological_process: transcription initiation from RNA polymerase II promoter.

These properties come from kegg analysis


KEGG_ORTHOLOGS: transcription initiation factor TFIIF subunit beta [EC:3.6.4.12] (K03139).

molecular_function: general RNA polymerase II transcription factor activity.

Locations

Located in CM3.5_scaffold01595 from 343358 to 344589.

This polypeptide in other databases

In PhylomeDB is Phy003MJ8Z_CUCME .

Related features