Polypeptide MELO3C003222P1
Accession: MELO3C003222P1
Name: MELO3C003222P1
Description: Similar to mRNA-capping enzyme (Mus musculus) (uniprot_sprot:sp|O55236|MCE1_MOUSE)
Sequence:
>MELO3C003222P1 Similar to mRNA-capping enzyme (Mus musculus) (uniprot_sprot:sp|O55236|MCE1_MOUSE) MIVSMDLNASPVPEDDEEAFERHEEVYIAPEEHIVTGVSIARREREERKRRLKRDRSLERPVHEYQQPARDQFYPSKNQK SDRNRLPPGWLDCPAFGQEICWMIPSKVPLGESFNDCIAPGKRYSFKQVIHQQRVWGRKLGLVIDLTNSYRYYTTSDLNK EGIKYVKIPCKGRDSVPDNKSVNTFVYEVIQFISRQKQQSKKYILVHCTHGHNRTGYMIINYLVRALSISVTQALKMFSD ARPPGIYKPDYVDALYTFYHERKPDAVVCPSTPEWKRSSDLDLNGEAVPDDDDDGGPAALLNENHDDGAQVMTNDDVLGD EIPEDQERGLKQFCYQMLKLNPGARANLQFPGSHPVSLNRDNLQLLRQRYYYATWKADGTRYMMLITMDGCYLIDRGFKF RRVQMRFPYRNANDGQVEKIHHYTLLDGEMIIDTMPDSQKQERRYLIYDMMAINYVSVIERPFYERWKMLEKEVIEPRNF ERQNIYQSRNPHYRYDLEPFRVRRKDFWLLSTVTKLLKEFIPRLSHDADGLIFQGWDDAYVPRTHEGLLKWKYPEMNSVD FLFELGEDDSQVLILFERGKRKTMEGNRVKFKDGDPSFYSGKIVECSWDSDEQVWVCMRIRTDKTTPNDFNTYKKVMRSI RDNITEEDLLKEIHEIIRLPMYADRIRNDSKAAQHTNSTRRR*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: protein tyrosine/serine/threonine phosphatase activity, ATP binding, protein tyrosine phosphatase activity, polynucleotide 5'-phosphatase activity, mRNA guanylyltransferase activity, DNA ligase (ATP) activity.
cellular_component: mitochondrion, nucleus.
biological_process: protein dephosphorylation, mRNA capping, DNA recombination, DNA repair, DNA replication.
These properties come from reactome analysis
REACTOME_REACTION: SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_102861), Dissociation of transcript with 5-GMP from GT (REACT_703), Formation of the CE:GMP intermediate complex (REACT_1580), Dissociation of transcript with 5-GMP from GT (REACT_106203), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_85239), Capping complex formation (REACT_77633), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_108201), Dissociation of transcript with 5-GMP from GT (REACT_90647), Activation of GT (REACT_893), Methylation of GMP-cap by RNA Methyltransferase (REACT_404), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_2233), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_423), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_102473), Capping complex formation (REACT_91663), Activation of GT (REACT_103525), Activation of GT (REACT_106797), Dissociation of transcript with 5-GMP from GT (REACT_87469), Methylation of GMP-cap by RNA Methyltransferase (REACT_97945), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_6295), Formation of the CE:GMP intermediate complex (REACT_101635), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_1368), Activation of GT (REACT_6298), Methylation of GMP-cap by RNA Methyltransferase (REACT_34170), Methylation of GMP-cap by RNA Methyltransferase (REACT_93915), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_1968), Capping complex formation (REACT_32400), Activation of GT (REACT_103913), Formation of the CE:GMP intermediate complex (REACT_79193), Formation of the CE:GMP intermediate complex (REACT_110689), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_6220), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_78922), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_109877), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_77279), Dissociation of transcript with 5-GMP from GT (REACT_101219), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_94470), Activation of GT (REACT_96305), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_96127), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_103482), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_81068), Capping complex formation (REACT_86608), Formation of the CE:GMP intermediate complex (REACT_92552), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_84917), Capping complex formation (REACT_2186), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_88439), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_103086), Methylation of GMP-cap by RNA Methyltransferase (REACT_96650), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_81891), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_95548).
biological_process: gene expression, viral transcription, viral reproduction, transcription from RNA polymerase II promoter, mRNA capping.
REACTOME_COMPLEX: Capping complex (GpppN..) [nucleoplasm] (REACT_2312), Capping complex (with freed 5- GMP) [nucleoplasm] (REACT_4741), RNA Pol II with phosphorylated CTD: CE complex with activated GT [nucleoplasm] (REACT_6659), RNA Pol II with phosphorylated CTD: CE complex [nucleoplasm] (REACT_2371), Covalent CE:GMP intermediate complex [nucleoplasm] (REACT_2774), Capping complex (initial) [nucleoplasm] (REACT_4555), mRNA capping factors [nucleoplasm] (REACT_4925), RNA Pol II with phosphorylated CTD: CE complex with activated GT [nucleoplasm] (REACT_3171), Capping complex (hydrolyzed) [nucleoplasm] (REACT_4969), Capping complex (intermediate) [nucleoplasm] (REACT_3580), CE:Pol II CTD:Spt5 complex [nucleoplasm] (REACT_2332), CE:Pol II CTD:Spt5 complex [nucleoplasm] (REACT_6491), RNA Pol II with phosphorylated CTD: CE complex [nucleoplasm] (REACT_6521).
REACTOME_PATHWAY: RNA Pol II CTD phosphorylation and interaction with CE (REACT_975), mRNA Processing (REACT_94551), RNA Pol II CTD phosphorylation and interaction with CE (REACT_6237), Transcription of the HIV genome (REACT_6233), Formation and Maturation of mRNA Transcript (REACT_77979), mRNA Processing (REACT_29019), RNA Pol II CTD phosphorylation and interaction with CE (REACT_28314), RNA Pol II CTD phosphorylation and interaction with CE (REACT_30624), Formation and Maturation of mRNA Transcript (REACT_85219), mRNA Processing (REACT_1675), Gene Expression (REACT_105649), mRNA Capping (REACT_81603), mRNA Capping (REACT_1470), Gene Expression (REACT_85241), Transcription (REACT_1788), RNA Pol II CTD phosphorylation and interaction with CE (REACT_96584), Formation and Maturation of mRNA Transcript (REACT_92291), Gene Expression (REACT_71), RNA Polymerase II Transcription (REACT_1366), HIV Life Cycle (REACT_6256), mRNA Capping (REACT_85081), mRNA Processing (REACT_109337), RNA Pol II CTD phosphorylation and interaction with CE (REACT_90040), Transcription (REACT_100899), RNA Polymerase II Transcription (REACT_106213), Formation and Maturation of mRNA Transcript (REACT_2039), Transcription (REACT_34268), Gene Expression (REACT_108313), RNA Polymerase II Transcription (REACT_97471), Transcription (REACT_99758), mRNA Capping (REACT_93735), HIV Infection (REACT_6185), Transcription (REACT_93622), Gene Expression (REACT_91657), RNA Polymerase II Transcription (REACT_89454), mRNA Capping (REACT_85562), Formation and Maturation of mRNA Transcript (REACT_32779), mRNA Processing (REACT_80866), Late Phase of HIV Life Cycle (REACT_6361), RNA Polymerase II Transcription (REACT_99228).
These properties come from phylome analysis
molecular_function: GTP binding, protein tyrosine/serine/threonine phosphatase activity, protein tyrosine phosphatase activity, polynucleotide 5'-phosphatase activity, mRNA guanylyltransferase activity.
cellular_component: nucleoplasm, nucleus.
biological_process: interspecies interaction between organisms, positive regulation of locomotion, locomotion, positive regulation of growth rate, growth, lipid storage, molting cycle, collagen and cuticulin-based cuticle, viral reproduction, body morphogenesis, embryo development ending in birth or egg hatching, determination of adult lifespan, receptor-mediated endocytosis, transcription from RNA polymerase II promoter, nematode larval development, morphogenesis of an epithelium, reproduction, protein dephosphorylation, mRNA capping.
These properties come from kegg analysis
KEGG_ORTHOLOGS: mRNA-capping enzyme [EC:2.7.7.50 3.1.3.33] (K13917).
molecular_function: polynucleotide 5'-phosphatase activity, mRNA guanylyltransferase activity.
This polypeptide in other databases
In PhylomeDB is Phy003A06R_CUCME .
