Polypeptide MELO3C003337P1

Accession: MELO3C003337P1

Name: MELO3C003337P1

Description: Similar to High affinity cationic amino acid transporter 1 (Homo sapiens) (uniprot_sprot:sp|P30825|CTR1_HUMAN)

Sequence:

>MELO3C003337P1 Similar to High affinity cationic amino acid transporter 1 (Homo sapiens) (uniprot_sprot:sp|P30825|CTR1_HUMAN)
MATAVFSTFLRHYLYSLSQTPHRLRKRMLATWTPDQELNQVRQRSGADMKRKLKWFDLIALGVGGMLGVGVFVTTGPVAL
HVTGPAVFLSYIIAGISALLSSLCYTEFSVHVSAAGGAFSYLRLTFGEFVGYFAGANIIMEYVLSNAAVARSFTEYLCVA
FGESEPNAWRVEVHGLLNGYNMLDFPAVGLILLLTLCLCHSTKESSTLNLIMTIFHVIFFGFIIGCGMYKGSAKNLVKPD
GLAPFGVKGVLDGAAIVYFSYIGYDSASTLAEEIQNPTKSLPIGIVGLCTASIALFTELYIVIEMISIGTLIVFYLVANA
TIYRRYAMVSKHPPSRILLFLLLLSCSAIGFSLSWKLNQQWWPGLLFFGVSTIFIITFFHYKFPSHNSSDAWSVPYMPWP
AATSIFLNVFLMTTLRMLSFQRFAIWSCLITLFYVVYGVHSTYKAEEIIMEVNNRVGEVTNNNNNNNVNSTIQQSKLDIQ
VL*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: SLC7A3 (CAT-3)-mediated uptake of cationic amino acids (REACT_14813), SLC7A2, isoform B (CAT-2B)-mediated uptake of cationic amino acids (REACT_106787), SLC7A1 (CAT-1)-mediated uptake of cationic amino acids (REACT_14850), SLC7A2, isoform A (CAT-2A)-mediated uptake of cationic amino acids (REACT_78882), SLC7A2, isoform B (CAT-2B)-mediated uptake of cationic amino acids (REACT_14845), SLC7A3 (CAT-3)-mediated uptake of cationic amino acids (REACT_82027), SLC7A2, isoform A (CAT-2A)-mediated uptake of cationic amino acids (REACT_14848).

biological_process: ion transport, cellular nitrogen compound metabolic process, transmembrane transport, amino acid transport.

REACTOME_PATHWAY: Metabolism of amino acids and derivatives (REACT_13), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_91958), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_19397), SLC-mediated transmembrane transport (REACT_19118), Amino acid transport across the plasma membrane (REACT_90553), Amino acid transport across the plasma membrane (REACT_13796), Amino acid and oligopeptide SLC transporters (REACT_30787), Amino acid and oligopeptide SLC transporters (REACT_19419), Transmembrane transport of small molecules (REACT_15518), Transmembrane transport of small molecules (REACT_86409), Metabolism of amino acids and derivatives (REACT_86268), SLC-mediated transmembrane transport (REACT_98716).

These properties come from phylome analysis


molecular_function: amino acid transmembrane transporter activity.

cellular_component: integral to membrane.

These properties come from blast2go analysis


molecular_function: amino acid transmembrane transporter activity.

cellular_component: integral to membrane, mitochondrion.

biological_process: transmembrane transport, amino acid transport.

Locations

Located in CM3.5_scaffold01596 from 404748 to 408009.

This polypeptide in other databases

In PhylomeDB is Phy003MFNC_CUCME .

Related features