Polypeptide MELO3C003341P1

Accession: MELO3C003341P1

Name: MELO3C003341P1

Description: Similar to Casein kinase II subunit beta (Arabidopsis thaliana) (uniprot_sprot:sp|P40228|CSK2B_ARATH)

Sequence:

>MELO3C003341P1 Similar to Casein kinase II subunit beta (Arabidopsis thaliana) (uniprot_sprot:sp|P40228|CSK2B_ARATH)
MHRDRPALGGVGTGSSKLDVTPIDRKRINDALDKQLERSSPSTSRTVINGKDNKPSAPQSLLMPKPLSDQRDSRSASLSK
TNCSEESETDSEESDVSGSDGDDTSWISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSQVPYYDYALDLILDVESSNGDM
FTEEQNELIESAAEMLYGLIHARYILTSKGMAAMLDKFKNYDFGRCPRVYCCGQPCLPVGQSDIPRAGTVKIYCPRCEDV
YYPRSKFQDIDGAYFGTTFPHLFLMTYGHHKPQKSIQSYVPRVFGFKIHKP*

Download fasta sequence.

Properties

These properties come from blast2go analysis

molecular_function: protein kinase regulator activity, kinase activity, protein binding.

cellular_component: protein kinase CK2 complex.

These properties come from reactome analysis

REACTOME_REACTION: Phosphorylation of L1 by CK-II (REACT_31915), Phosphorylation of L1 by CK-II (REACT_102711), Phosphorylation of L1 by CK-II (REACT_22378).

biological_process: axon guidance.

REACTOME_COMPLEX: Casein kinase II [cytosol] (REACT_23098), pL1:CK-II [plasma membrane] (REACT_22634).

REACTOME_PATHWAY: Axon guidance (REACT_29862), L1CAM interactions (REACT_89546), Axon guidance (REACT_110262), L1CAM interactions (REACT_94606), L1CAM interactions (REACT_22205), Signal transduction by L1 (REACT_94201), Signal transduction by L1 (REACT_89899), Signal transduction by L1 (REACT_22272), Axon guidance (REACT_18266).

These properties come from phylome analysis

molecular_function: protein kinase regulator activity, kinase activity.

cellular_component: protein kinase CK2 complex.

These properties come from kegg analysis

KEGG_PATHWAY: Herpes simplex infection (ko05168), Tight junction (ko04530), Adherens junction (ko04520).

KEGG_ORTHOLOGS: casein kinase II subunit beta (K03115).

Locations

Located in CM3.5_scaffold01596 from 433753 to 438471.

This polypeptide in other databases

In PhylomeDB is Phy003ACLS_CUCME .

Related features