Polypeptide MELO3C003472P1

Accession: MELO3C003472P1

Name: MELO3C003472P1

Description: Similar to Tryptophanyl-tRNA synthetase (Nostoc sp. (strain PCC 7120 / UTEX 2576)) (uniprot_sprot:sp|Q8YXE4|SYW_NOSS1)

Sequence:

>MELO3C003472P1 Similar to Tryptophanyl-tRNA synthetase (Nostoc sp. (strain PCC 7120 / UTEX 2576)) (uniprot_sprot:sp|Q8YXE4|SYW_NOSS1)
MGRALLSHFLVLSQSSTRFTPSPSLSAFGTKYTKPHSLFPLNRSSTGNSSRCCCGISLTEPAAAPERPPSSIKQRIVSGV
QPTGSIHLGNYLGAIKNWISLQDTYDTLFFIVDLHAITLPYDTQQLHKATRDTAAIYLACGVDTSKASVFVQSHVRAHVE
LMWLLSSATPIGWLNRMIQFKEKSRKAGDENVGVALLTYPVLMASDILLYQSDFVPVGEDQKQHLELTRELAERVNYLYG
GRKWKKLGGRGGVIFKVPEPLIPPAGARVMSLTDGLSKMSKSAPSDQSRINLLDPKDVIANKIKRCKTDSFPGLVQKLQT
LLLEFDNPERPECNNLLTIYQLVSGKGKEDVKQECENMNWGSFKILLTDALVDHLHPIQVRYNEIISDPAFLDEVLADGA
RKASSIADVTVNNLYQAMGFFRR*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: ATP binding, tryptophan-tRNA ligase activity.

cellular_component: chloroplast, mitochondrion.

biological_process: tryptophanyl-tRNA aminoacylation.

These properties come from reactome analysis


REACTOME_REACTION: tryptophan + tRNA(Trp) + ATP => Trp-tRNA(Trp) + AMP + pyrophosphate (REACT_91521), tryptophan + tRNA(Trp) + ATP => Trp-tRNA(Trp) + AMP + pyrophosphate (REACT_110778), tryptophan + tRNA(Trp) + ATP => Trp-tRNA(Trp) + AMP + pyrophosphate (REACT_77807), tryptophan + tRNA(Trp) + ATP => Trp-tRNA(Trp) + AMP + pyrophosphate (REACT_100666), tryptophan + tRNA(Trp) + ATP => Trp-tRNA(Trp) + AMP + pyrophosphate (REACT_15343).

biological_process: tRNA aminoacylation for protein translation, gene expression.

REACTOME_PATHWAY: Mitochondrial tRNA aminoacylation (REACT_34656), Gene Expression (REACT_98256), Gene Expression (REACT_108313), tRNA Aminoacylation (REACT_33855), Gene Expression (REACT_91657), Mitochondrial tRNA aminoacylation (REACT_15302), Gene Expression (REACT_105649), Gene Expression (REACT_71), Mitochondrial tRNA aminoacylation (REACT_81996), tRNA Aminoacylation (REACT_103575), tRNA Aminoacylation (REACT_99090), tRNA Aminoacylation (REACT_80723), Mitochondrial tRNA aminoacylation (REACT_100487), tRNA Aminoacylation (REACT_15482), Mitochondrial tRNA aminoacylation (REACT_88111).

These properties come from phylome analysis


molecular_function: identical protein binding, protein binding, ATP binding, tryptophan-tRNA ligase activity.

cellular_component: mitochondrial matrix, cytoplasm, chloroplast, mitochondrion.

biological_process: mitochondrial tryptophanyl-tRNA aminoacylation, ovule development, tryptophanyl-tRNA aminoacylation.

These properties come from kegg analysis


KEGG_REACTION: L-Tryptophan (R03664).

molecular_function: tryptophan-tRNA ligase activity.

COG: Tryptophanyl-tRNA synthetase (COG0180).

KEGG_PATHWAY: Aminoacyl-tRNA biosynthesis (ko00970).

KEGG_ORTHOLOGS: tryptophanyl-tRNA synthetase [EC:6.1.1.2] (K01867).

KEGG_MODULE: Aminoacyl-tRNA biosynthesis, prokaryotes (M00360), Aminoacyl-tRNA biosynthesis, eukaryotes (M00359).

Locations

Located in CM3.5_scaffold01596 from 1509355 to 1517467.

This polypeptide in other databases

In PhylomeDB is Phy003LI2H_CUCME .

Related features