Polypeptide MELO3C003672P1
Accession: MELO3C003672P1
Name: MELO3C003672P1
Description: Similar to Cyclin-A2-2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q147G5|CCA22_ARATH)
Sequence:
>MELO3C003672P1 Similar to Cyclin-A2-2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q147G5|CCA22_ARATH) MAPQRSAASRDRGVIDIDSNSKCLQSCSTYAPDIYDRIRVTELDQRASTNYMEQLQQDITANMRGILVDWLVEVSEEYNL VSDTFYLTVNLIDRFLSQNYIEKKRLQLVGVASMLIASKYEEICAPRVEDFCFITDNTYTKGEVVEMESEVLNILHFRLS VPTTKTFLRRFIQSAHASYKVPCIELEFLANYLAELTLVEYSFLKFLPSLIAASAVFLARWTLDQSDHPWNPTLEHYTSY DVSQLKTVVLALQDLQLNTSASSLNAIRQKYKQPKFKCVATLTSTKSVLSLF*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Translocation of Cyclin A:Cdk2 complexes to the nucleus (REACT_9065), Cdc25A mediated dephosphorylation of Cyclin A:phospho-Cdk2 (REACT_9062), Binding of phospho-p27/p21:Cdk2:Cyclin E/A to the SCF(Skp2):Cks1 complex (REACT_9060), Dephosphorylation of cyclin B2:phospho-Cdc2 (Thr 14) by Cdc25 (REACT_6175), Myt-1 mediated phosphorylation of Cyclin B:Cdc2 complexes (REACT_6217), Formation of Cyclin B:Cdc2 complexes (REACT_6216), Phosphorylation of proteins involved in G2/M transition by active Cyclin A1:Cdc2 complexes (REACT_406), Translocation of Cyclin A:phospho-Cdc2 (Thr 14) to the nucleus (REACT_6276), Cyclin A:Cdk2 mediated phosphorylation of p27/p21 (REACT_8995), Formation of Cyclin A:Cdk2 complexes (REACT_8996), Cyclin E/A:Cdk2-mediated phosphorylation of p27/p21 (REACT_8998), Association of Cyclin A with the APC/C (REACT_6830), Inactivation of Cyclin A:Cdk2 complexes by p27/p21 (REACT_9005), Phosphorylation of proteins involved in the G1/S transition by Cyclin A:Cdk2 (REACT_9007), Dephosphorylation of nuclear Cyclin A:phosph-Cdc2 complexes (REACT_6294), Phosphorylation of E2F1/E2F3 by Cyclin A:phosph-Cdk2(Thr 160) (REACT_9023), Association of Cyclin A:phospho-Cdk2(Thr 160) with E2F1/E2F3 (REACT_9021), Ubiquitination of phospho-p27/p21 (REACT_9026), Phosphorylation of Cdh1 by Cyclin A:Cdk2 (REACT_31143), Myt-1 mediated phosphorylation of Cyclin A:Cdc2 (REACT_6342), CAK-mediated phosphorylation of Cyclin A:Cdk2 (REACT_9070), Formation of Cyclin A:Cdc2 complexes (REACT_6308), Wee1-mediated phosphorylation of Cyclin A:phospho-Cdc2 complexes (REACT_6327), Orc1 is phosphorylated by cyclin A/CDK2 (REACT_2111), Phosphorylation of proteins involved in G2/M transition by active Cyclin A2:Cdc2 complexes (REACT_1627), Ubiquitination of Cyclin A by APC/C:Cdc20 complex (REACT_6824), Phosphorylation of Cdh1 by Cyclin A:Cdk2 (REACT_6721), Ubiquitination of Cyclin A by APC/C:Cdc20 complex (REACT_101618), Phosphorylation of Cyclin A:Cdk2 at Tyr 15 (REACT_9057), Phosphorylation of proteins involved in G2/M transition by active Cyclin B2:Cdc2 complexes (REACT_852), CAK-mediated phosphorylation of Cyclin A:Cdc2 complexes (REACT_6139), Association of Cyclin A:Cdk2 with Cdh1 (REACT_9051).
biological_process: cell cycle checkpoint, anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process, mitotic cell cycle, regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle, G1/S transition of mitotic cell cycle, G2 phase of mitotic cell cycle, S phase of mitotic cell cycle, G2/M transition of mitotic cell cycle.
REACTOME_COMPLEX: Cyclin A:phospho-Cdk(Thr 160):Cdh1:phosho-APC/C complex [nucleoplasm] (REACT_9153), Cyclin A:Cdk2 complex [nucleoplasm] (REACT_4932), Cyclin E/A:Cdk2:phospho-p27/p21 [nucleoplasm] (REACT_9321), Cyclin A:Cdk2:phospho-p27/p21 complex [nucleoplasm] (REACT_9145), Cyclin A1:phospho-Cdc2(Thr161) [nucleoplasm] (REACT_4408), Cyclin A:phospho-Cdk2(Tyr 15) [nucleoplasm] (REACT_9202), Cyclin A:phospho-Cdc2(Thr 14) [nucleoplasm] (REACT_6613), Cyclin A:phospho-Cdk2(Thr160):phospho-E2F1/E2F2 complex [nucleoplasm] (REACT_9267), multiubiquitinated Cyclin A associated with MCC:APC/C complex [cytosol] (REACT_7710), Cyclin A:phospho-Cdc2(Thr 14, Thr 161) [nucleoplasm] (REACT_6673), Cyclin A:Cdk2:substrate complex [nucleoplasm] (REACT_9192), Cyclin E/A:Cdk2:multiubiquitinated phospho-p27/p21:SCF(Skp2):Cks1 complex [nucleoplasm] (REACT_9266), Cyclin A:Cdc2 [cytosol] (REACT_6461), Cyclin A:phospho-Cdk2(Thr160) complex [nucleoplasm] (REACT_9292), Cyclin B2:phospho-Cdc2(Thr 14, Thr 161) [cytosol] (REACT_6445), Cyclin A:phospho-Cdk2(Thr160):E2F1/E2F3 complex [nucleoplasm] (REACT_9177), Cyclin B:Cdc2 complex [cytosol] (REACT_6447), Cyclin E/A:Cdk2:phospho-p27/p21:SCF(Skp2):Cks1 complex [nucleoplasm] (REACT_9193), Cyclin A:Cdk2:p21/p27 complex [nucleoplasm] (REACT_9335), Cyclin E/A:Cdk2:p27/p21 complex [nucleoplasm] (REACT_9314), Cyclin E/A:Cdk2 [nucleoplasm] (REACT_9091), Cyclin A:Cdk2:phosphorylated substrate complex [nucleoplasm] (REACT_9299), Cyclin A2:phospho-Cdc2(Thr 161) [nucleoplasm] (REACT_4651), Cyclin B2:phospho-Cdc2(Thr 161) [cytosol] (REACT_4066), Cyclin B:phospho-Cdc2(Thr 14) [cytosol] (REACT_6524), Cyclin A:phospho-Cdc2(Thr 161, Thr 14, Tyr 15) [nucleoplasm] (REACT_6620), Cyclin A:phospho-Cdc2(Thr 161) [nucleoplasm] (REACT_6644), Cyclin A:phospho-Cdk2(Thr 160):phospho-Cdh1:phospho-APC/C complex [nucleoplasm] (REACT_9272), Cyclin A:Cdk2 complex [cytosol] (REACT_9350), Cyclin A:phospho-Cdc2(Thr 161) complex [cytosol] (REACT_7745), phospho-Cdc2(Thr 14):Cyclin A [cytosol] (REACT_6681), Cdc2:Cyclin A:MCC:APC/C complex [cytosol] (REACT_7458).
REACTOME_PATHWAY: Cdc20:Phospho-APC/C mediated degradation of Cyclin A (REACT_89027), APC/C-mediated degradation of cell cycle proteins (REACT_95731), Switching of origins to a post-replicative state (REACT_2148), DNA Replication (REACT_383), Cyclin B2 mediated events (REACT_2101), G2/M DNA replication checkpoint (REACT_1846), G2/M Transition (REACT_2203), Orc1 removal from chromatin (REACT_1156), G2 Phase (REACT_1915), Cdc20:Phospho-APC/C mediated degradation of Cyclin A (REACT_6850), Regulation of mitotic cell cycle (REACT_79690), Cell Cycle, Mitotic (REACT_152), G1/S Transition (REACT_1783), Removal of licensing factors from origins (REACT_207), Cyclin E associated events during G1/S transition (REACT_1574), Regulation of APC/C activators between G1/S and early anaphase (REACT_6837), Cyclin A:Cdk2-associated events at S phase entry (REACT_9029), SCF(Skp2)-mediated degradation of p27/p21 (REACT_9003), Cell Cycle, Mitotic (REACT_85950), Regulation of DNA replication (REACT_829), G2/M Checkpoints (REACT_828), Cyclin A/B1 associated events during G2/M transition (REACT_1857), Synthesis of DNA (REACT_2014), Cell Cycle Checkpoints (REACT_1538), Mitotic G1-G1/S phases (REACT_21267), Regulation of APC/C activators between G1/S and early anaphase (REACT_97346), S Phase (REACT_899), Mitotic G2-G2/M phases (REACT_21391), Regulation of mitotic cell cycle (REACT_21279), APC/C-mediated degradation of cell cycle proteins (REACT_6828), Phosphorylation of proteins involved in the G2/M transition by Cyclin A:Cdc2 complexes (REACT_6362).
These properties come from blast2go analysis
molecular_function: protein binding.
cellular_component: nucleus.
biological_process: cell division, cell cycle.
This polypeptide in other databases
In PhylomeDB is Phy003MEQZ_CUCME .

