Polypeptide MELO3C003703P1
Accession: MELO3C003703P1
Name: MELO3C003703P1
Description: Similar to UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter (Fragment) (Sus scrofa) (uniprot_sprot:sp|Q15B89|S35D2_PIG)
Sequence:
>MELO3C003703P1 Similar to UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter (Fragment) (Sus scrofa) (uniprot_sprot:sp|Q15B89|S35D2_PIG) MSLKPSNSEKNLMLPVSDPPHGTEDKDRLIRGDEKLFRGSSMTKRGAYAALSYMACAVLLVLFNKAALSSYNFPSANVVT LVQMVCSCCFLYALRRWKVISFTVGDSFSDNATSMVPIKTLRQTSPLAGTYLLYMLATMESVRGVNVPMYTTLRRTTVVF TMVVEYLLAGQKYTYSVVGSVGLIVLGAFIAGARDLSFDVYGYSIVFMSNITTAIYLATISRIGKSSGLNSFGLMWCNGV LCAPVLLFWTFIRGDLEATISFPHLFSPGFLVVMFCSCTLAFFLNYSIFLNTTLNSAVTQTICGNLKDLFTIGLGWMIFG GLPFDLLNVIGQLLGFIGSGLYAYYKLIGK*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: UDP-glucuronate transport from the cytosol to ER lumen (REACT_34308), SLC35D2 mediates the antiport of GDP-mannose in exchange for GMP (REACT_22122), UDP-glucuronate transport from the cytosol to ER lumen (REACT_95534), SLC35D2 mediates the antiport of UDP-sugars in exchange for UMP (REACT_22287), UDP-glucuronate transport from the cytosol to ER lumen (REACT_79113), UDP-glucuronate transport from the cytosol to ER lumen (REACT_32989), UDP-glucuronate transport from the cytosol to ER lumen (REACT_6892).
biological_process: UDP-glucuronate biosynthetic process, transmembrane transport, xenobiotic metabolic process.
REACTOME_COMPLEX: UDP-glucuronate transporter homohexamer [endoplasmic reticulum membrane] (REACT_7361).
REACTOME_PATHWAY: Transmembrane transport of small molecules (REACT_102897), SLC-mediated transmembrane transport (REACT_87124), Transport of vitamins, nucleosides, and related molecules (REACT_83031), Glucuronidation (REACT_81393), Transport of vitamins, nucleosides, and related molecules (REACT_22285), Biological oxidations (REACT_13433), Formation of the active cofactor, UDP-glucuronate (REACT_82919), Biological oxidations (REACT_78106), Phase II conjugation (REACT_6959), Transport of vitamins, nucleosides, and related molecules (REACT_110339), Transport of vitamins, nucleosides, and related molecules (REACT_32863), Formation of the active cofactor, UDP-glucuronate (REACT_95140), Biological oxidations (REACT_90526), Formation of the active cofactor, UDP-glucuronate (REACT_6737), Phase II conjugation (REACT_87255), Biological oxidations (REACT_100603), Glucuronidation (REACT_90051), Transport of nucleotide sugars (REACT_88804), Transport of nucleotide sugars (REACT_97756), Transport of nucleotide sugars (REACT_32477), Transport of nucleotide sugars (REACT_22151), SLC-mediated transmembrane transport (REACT_101577), SLC-mediated transmembrane transport (REACT_19118), Glucuronidation (REACT_6784), Transport of nucleotide sugars (REACT_79798), Formation of the active cofactor, UDP-glucuronate (REACT_84890), Transport of vitamins, nucleosides, and related molecules (REACT_77720), Phase II conjugation (REACT_31665), Transmembrane transport of small molecules (REACT_15518), Glucuronidation (REACT_79847), Transmembrane transport of small molecules (REACT_86409), Formation of the active cofactor, UDP-glucuronate (REACT_88063), SLC-mediated transmembrane transport (REACT_98716), Transmembrane transport of small molecules (REACT_81024), Transmembrane transport of small molecules (REACT_97365), Phase II conjugation (REACT_89411), SLC-mediated transmembrane transport (REACT_96636), Glucuronidation (REACT_32777), Biological oxidations (REACT_83999), Phase II conjugation (REACT_102710).
These properties come from phylome analysis
molecular_function: antiporter activity, protein binding, UDP-xylose transmembrane transporter activity, UDP-N-acetylglucosamine transmembrane transporter activity, UDP-glucuronic acid transmembrane transporter activity, UDP-glucose transmembrane transporter activity, UDP-galactose transmembrane transporter activity.
cellular_component: Golgi membrane, integral to membrane.
biological_process: vulval development, oviposition, embryo development ending in birth or egg hatching, imaginal disc-derived wing morphogenesis, imaginal disc pattern formation, segment polarity determination, morphogenesis of an epithelium, compound eye morphogenesis, carbohydrate transport.
These properties come from blast2go analysis
cellular_component: integral to membrane.
biological_process: carbohydrate transport.
This polypeptide in other databases
In PhylomeDB is Phy003A9NQ_CUCME .
