Polypeptide MELO3C003722P1

Accession: MELO3C003722P1

Name: MELO3C003722P1

Description: Similar to Serine/threonine-protein kinase HT1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q2MHE4|HT1_ARATH)

Sequence:

>MELO3C003722P1 Similar to Serine/threonine-protein kinase HT1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q2MHE4|HT1_ARATH)
MLHVDWLTMKNFCMPLVLKHHPNTFRPMHEITISTIDKPKLLSQLTSLLSEIGLNIQEAHAFSTTDGFSLDVFVVDGWII
EDTKQLKDILAEEISKIQKRHPPFTPCIFHTEKQDRFGVKFTTKYVNIPRDEVDAWEIDASLLVFEKKIASGSLSDLYKG
TFCGQDVAIKLLKNENLNETVRREFVQEIHIMRKLRHKNVVQFIGASTRPPSFFIVTEYMSGGSIHDFLHQQKGVLSFPS
LLRVAIDVSKGMDYLHQKNIIHRDLKAANLLMDEYGVVKVADFGVARVLAQSGVMTAETGTYRWMAPEVIEHKPYDHKAD
VYSFGIVLWELLTGQLPYNNLTPLQAAIGVVQKGLRPKIPRHAHPMIVDLLEKCWLQDPSLRPEFSEITRLLQQTPPKEE
PSGR*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: amino acid binding, ATP binding, protein serine/threonine kinase activity.

cellular_component: plastid.

biological_process: protein phosphorylation.

These properties come from reactome analysis


REACTOME_REACTION: Cables link CDK5 and ABL1 (REACT_25197), Recruitment of CAP to Abl (REACT_19260), Interaction of Abl with Robo1:Slit2 (REACT_19396), Phosphorylation of Rob1 by Abl kinase (REACT_19227), Interaction of p38 MAPK with JLP (REACT_21282), Interaction of ABL1 with CDO complex (REACT_21341), Activation of CLASP (REACT_19182).

biological_process: muscle cell differentiation, positive regulation of muscle cell differentiation, axon guidance, blood coagulation.

REACTOME_COMPLEX: Abl:pRobo1:slit2:Glypican-1 [plasma membrane] (REACT_19439), Clasp:Abl:Robo1:Slit2:Glypican-1 [plasma membrane] (REACT_19830), CDK5:CABLES:ABL [cytosol] (REACT_26864), ABL1:JLP:CDO complex [plasma membrane] (REACT_21587), p38 alpha/beta/gamma:ABL1:JLP:CDO complex [plasma membrane] (REACT_21610), CAP:Abl:Robo1:Slit2:Glypican-1 [plasma membrane] (REACT_20355), pp38 alpha/beta/gamma:ABL1:JLP:CDO complex [plasma membrane] (REACT_21750), Abl:Robo1:Slit2:Glypican-1 [plasma membrane] (REACT_19950).

REACTOME_PATHWAY: CDO in myogenesis (REACT_21402), Factors involved in megakaryocyte development and platelet production (REACT_24970), Signaling by Robo receptor (REACT_19351), Myogenesis (REACT_21303), Hemostasis (REACT_604), Role of Abl in Robo-Slit signaling (REACT_19230), Axon guidance (REACT_18266).

These properties come from phylome analysis


molecular_function: non-membrane spanning protein tyrosine kinase activity, amino acid binding, ATP binding, protein serine/threonine kinase activity.

biological_process: protein phosphorylation.

These properties come from kegg analysis


KEGG_PATHWAY: Osteoclast differentiation (ko04380).

KEGG_ORTHOLOGS: tec protein tyrosine kinase [EC:2.7.10.2] (K07364).

Locations

Located in CM3.5_scaffold01596 from 3576703 to 3580994.

This polypeptide in other databases

In PhylomeDB is Phy003LNG2_CUCME .

Related features