Polypeptide MELO3C003976P2
Accession: MELO3C003976P2
Name: MELO3C003976P2
Description: Similar to Putative clathrin assembly protein At4g25940 (Arabidopsis thaliana) (uniprot_sprot:sp|Q8VYT2|CAP6_ARATH)
Sequence:
>MELO3C003976P2 Similar to Putative clathrin assembly protein At4g25940 (Arabidopsis thaliana) (uniprot_sprot:sp|Q8VYT2|CAP6_ARATH) MALSKIPPRSASLRSTANSRIWISPSLRLPITLNVRLKNVMFEVALKTLIVVHRTLREGDPTFREELLNYSHRGHILQIS NFKDDSSPLAWDCSAWVRTYALFLEERLECYRILKYDIESERLTKTSPGSTKVHSRTRLLNSDELLEQLPALQQLLYRLM GCQPEGGAYSNYLIQYALALVLKESFKIYCAINDGIINLVDMFFDMPRHDAVKALNIYKRASNQAENLADFYEYCKGLEL ARTFQFPTLKQPPPSFLSTMEEYIREAPQTGSVNKRLEYRETELLTQEEDKPEESAEIEKEVENVEDNKPLVETEEEPQQ KEEEVAEPPPLIETHDPSDLLGLNEINPKAAEIEESNALALAIVTNGNDPSSSNRALSEIGGSGWELALVTTPSNNTGPS VEGRLAGGFDKLLLDSLYEDEHARRHLQLQNAGYGPYGEMMVQNPFEQHDPFSLSSNIAPPPNVQMAMMAQQQQMLFQHQ QQPLQSNTFPQQQQQLHSNDSMMMVPYQQQLPQYPQQQMQQIGPSNPFGDPFLSFPQTSVPPGGHHNLI*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: clathrin binding, oxidoreductase activity, 1-phosphatidylinositol binding.
cellular_component: clathrin coat, mitochondrion.
biological_process: clathrin coat assembly.
These properties come from phylome analysis
molecular_function: 2-alkenal reductase activity, clathrin binding, 1-phosphatidylinositol binding.
cellular_component: clathrin coat.
biological_process: oxidation-reduction process, clathrin coat assembly.
This polypeptide in other databases
In PhylomeDB is Phy003ADFB_CUCME .

