Polypeptide MELO3C004105P1

Accession: MELO3C004105P1

Name: MELO3C004105P1

Description: Similar to Putative uncharacterized protein (Glycine max) (uniref90:UniRef90_C6T6B8)

Sequence:

>MELO3C004105P1 Similar to Putative uncharacterized protein (Glycine max) (uniref90:UniRef90_C6T6B8)
MDEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLTAKGEESGECERFAKYYRALCPGEWVDKWNEQRENGTFPGPL*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: cytochrome-c oxidase activity.

cellular_component: thylakoid, chloroplast, mitochondrial respiratory chain complex IV.

biological_process: response to salt stress, aerobic respiration, mitochondrial electron transport, cytochrome c to oxygen.

These properties come from reactome analysis


REACTOME_REACTION: Electron transfer from reduced cytochrome c to molecular oxygen (REACT_6149).

REACTOME_PATHWAY: Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_6305), Respiratory electron transport (REACT_22393).

REACTOME_COMPLEX: Cytochrome c oxidase [mitochondrial inner membrane] (REACT_6661).

biological_process: respiratory electron transport chain.

These properties come from phylome analysis


molecular_function: cytochrome-c oxidase activity.

cellular_component: mitochondrion.

biological_process: oxidation-reduction process.

These properties come from kegg analysis


molecular_function: cytochrome-c oxidase activity.

Locations

Located in CM3.5_scaffold00003 from 3978438 to 3982579.

This polypeptide in other databases

In PhylomeDB is Phy003LNO6_CUCME .

Related features