Polypeptide MELO3C004111P1

Accession: MELO3C004111P1

Name: MELO3C004111P1

Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_37.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7U1G4)

Sequence:

>MELO3C004111P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_37.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7U1G4)
MAILSPQQQPQIHRFPQFKYVDGVRWLPPLSAFTRFAVIALFDSDFDSSSIEIHSLTQNPLDIAPHSTWVSPSRVSSLKT
SQLHQNPLVFASTYTGSLHVLSVEPMEASLDSELSVPEKMLHDGPISCVDVMDSGGECLTVSEDGRVNLVSVGESGLNYR
RIFDSNGLVSYNAVKWASPTEFVTGGCGFSLQWWDQRKPGGAVSQFKADWASGIVHCIDIHPSRKHTCLAGGSFGTVFAW
DLRSQQQPIILSGLEGTKTSNPSPCESEVWEVHYDPYIKSGNLGGMSSTQILPAMICSEDGILTSIEQGKEPVELLAEPC
AINGFDIDRQHPSEVICNLEWESVAILSRS*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Rev multimer-bound HIV-1 mRNA:Crm1:Ran:GTP complex associates with the NPC (REACT_6337), Translocation of nuclear RNA transport complex to cytoplasm (REACT_6340), Kinetochore capture of astral microtubules (REACT_14798), Rev:importin beta:B23 recruited to the nuclear pore (REACT_9516), GCK1:GKRP [cytosol] => GCK1:GKRP [nucleoplasm] (REACT_6938), Translocation of Rev:importin-beta:B23 to the nucleus (REACT_9521), Vpr binds nucleoporins (REACT_7952).

biological_process: mitotic cell cycle, hexose transport, M phase of mitotic cell cycle, transmembrane transport, viral reproduction, glucose transport, regulation of glucose transport, carbohydrate metabolic process, mitotic prometaphase.

REACTOME_COMPLEX: PIC anchored to the NPC [nuclear envelope] (REACT_8912), nucleoporin-associated Rev:Importin-beta:B23 complex [nuclear envelope] (REACT_9793), Nup107-160 complex [cytosol] (REACT_15280), Nuclear Pore Complex (NPC) [nuclear envelope] (REACT_5542), Kinetochore [cytosol] (REACT_14970), Microtubule-bound kinetochore [cytosol] (REACT_15175), Rev multimer-bound HIV-1 mRNA:Crm1:Ran:GTP:NPC [nuclear envelope] (REACT_6537).

REACTOME_PATHWAY: M Phase (REACT_910), DNA Replication (REACT_383), Interactions of Rev with host cellular proteins (REACT_6916), Mitotic Prometaphase (REACT_682), Cell Cycle, Mitotic (REACT_152), Mitotic M-M/G1 phases (REACT_21300), Interactions of Vpr with host cellular proteins (REACT_6757), Vpr-mediated nuclear import of PICs (REACT_7991), HIV Life Cycle (REACT_6256), SLC-mediated transmembrane transport (REACT_19118), Rev-mediated nuclear export of HIV-1 RNA (REACT_6190), Transmembrane transport of small molecules (REACT_15518), Nuclear import of Rev protein (REACT_9395), HIV Infection (REACT_6185), Hexose transport (REACT_9441), Host Interactions of HIV factors (REACT_6288), Glucose transport (REACT_212), Metabolism of carbohydrates (REACT_474), Regulation of Glucokinase by Glucokinase Regulatory Protein (REACT_6804), Late Phase of HIV Life Cycle (REACT_6361).

These properties come from phylome analysis


molecular_function: protein binding.

cellular_component: Nup107-160 complex, chloroplast, cytosol, nuclear envelope, condensed chromosome kinetochore.

biological_process: transmembrane transport, cell division, mRNA transport, viral reproduction, glucose transport, protein transport, regulation of glucose transport, mitosis, chromosome segregation, carbohydrate metabolic process, mitotic prometaphase.

Locations

Located in CM3.5_scaffold00003 from 4060948 to 4066240.

This polypeptide in other databases

In PhylomeDB is Phy003A4F2_CUCME .

Related features