Polypeptide MELO3C004196P1

Accession: MELO3C004196P1

Name: MELO3C004196P1

Description: Similar to GTP-binding protein SAR1A (Arabidopsis thaliana) (uniprot_sprot:sp|O04834|SAR1A_ARATH)

Sequence:

>MELO3C004196P1 Similar to GTP-binding protein SAR1A (Arabidopsis thaliana) (uniprot_sprot:sp|O04834|SAR1A_ARATH)
MFLVDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRV
WKDYYAKVDAVVYLVDAYDKERFTESKKELDALLSDEALADVPFLILGNKIDIPYAASEDELRYNLGLTNFTTGKGKVNL
GDSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIK*

Download fasta sequence.

Properties

These properties come from blast2go analysis

molecular_function: GTP binding.

cellular_component: cytoplasmic membrane-bounded vesicle, plasma membrane, Golgi apparatus, endoplasmic reticulum.

biological_process: vesicle-mediated transport, intracellular protein transport.

These properties come from reactome analysis

REACTOME_REACTION: Sar1p Activation And Membrane Binding (REACT_84621), Loss of Sar1b GTPase (REACT_101563), Vesicle Budding (REACT_91081), Coat Assembly (REACT_33645).

REACTOME_PATHWAY: COPII (Coat Protein 2) Mediated Vesicle Transport (REACT_77017), Transport to the Golgi and subsequent modification (REACT_107027), Post-translational protein modification (REACT_101114), Asparagine N-linked glycosylation (REACT_94271), ER to Golgi Transport (REACT_32610), Membrane Trafficking (REACT_86557), Metabolism of proteins (REACT_102155).

biological_process: protein N-linked glycosylation via asparagine, post-translational protein modification, cellular membrane organization, cellular protein metabolic process, ER to Golgi vesicle-mediated transport, COPII vesicle coating.

These properties come from kegg analysis

KEGG_ORTHOLOGS: GTP-binding protein SAR1 [EC:3.6.5.-] (K07953).

KEGG_MODULE: COPII complex (M00404).

COG: GTPase SAR1 and related small G proteins (COG1100).

Locations

Located in CM3.5_scaffold00003 from 4817725 to 4820618.

This polypeptide in other databases

In PhylomeDB is Phy003A68U_CUCME .

Related features