Polypeptide MELO3C004216P1

Accession: MELO3C004216P1

Name: MELO3C004216P1

Description: Similar to F-actin-capping protein subunit alpha (Arabidopsis thaliana) (uniprot_sprot:sp|O82631|CAPZA_ARATH)

Sequence:

>MELO3C004216P1 Similar to F-actin-capping protein subunit alpha (Arabidopsis thaliana) (uniprot_sprot:sp|O82631|CAPZA_ARATH)
MADEEVELSDEQKKEIAKWFLLNAPAGEIQFVAKDVKKILNDDELYHEAASEAFPQYNKSHMICIEMPGRVGDVIITPFN
ELEENEFLDPRTAQVAIIDNIKQVCTEVRHALDEELPSAYVEEFRCAVDMEVSRYVGEAYPKGVCSVYCVNGKDVEGPES
DFELAVVIAAARHSPQNFCNGSWRSTWNIEFKGDFQSLEIRGKMQVFSAPEDCAVAIANIIRHHEAEYLASLETSYSNLP
DTTFKDLRRKLPVTRTLFPWHNTSQFSLTRDIAKELGIGK*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: actin binding.

cellular_component: F-actin capping protein complex.

biological_process: actin cytoskeleton organization.

These properties come from reactome analysis


REACTOME_REACTION: The TRTK-12 fragment of F-actin capping protein alpha binds the AGER ligand S100B (REACT_25219), F-actin capping protein binds to the barbed end of elongating F-actin (REACT_25135), LRRC16A binds F-actin capping protein (REACT_25319), F-actin capping protein is a heterodimer (REACT_25363).

biological_process: blood coagulation, innate immune response.

REACTOME_COMPLEX: LRRC16A:F-actin capping protein [cytosol] (REACT_26939), F-actin capping protein:f-actin [cytosol] (REACT_26552), F-actin capping protein [cytosol] (REACT_26977), F-actin capping protein fragment TRTK12:S100B homodimer [extracellular region] (REACT_26773).

REACTOME_PATHWAY: Immune System (REACT_6900), Factors involved in megakaryocyte development and platelet production (REACT_24970), Advanced glycosylation endproduct receptor signaling (REACT_25195), Hemostasis (REACT_604), Innate Immunity Signaling (REACT_6802).

These properties come from phylome analysis


molecular_function: actin filament binding, actin binding.

cellular_component: mating projection tip, actin cortical patch, apical plasma membrane, actin filament, microtubule associated complex, nucleus, F-actin capping protein complex.

biological_process: actin filament capping, barbed-end actin filament capping, positive regulation of growth rate, growth, wing disc development, regulation of lamellipodium assembly, embryo development ending in birth or egg hatching, germarium-derived oocyte fate determination, actin filament organization, phagocytosis, engulfment, nematode larval development, reproduction, actin cytoskeleton organization.

These properties come from kegg analysis


KEGG_ORTHOLOGS: capping protein (actin filament) muscle Z-line, alpha (K10364).

Locations

Located in CM3.5_scaffold00003 from 5003672 to 5012964.

This polypeptide in other databases

In PhylomeDB is Phy003LHR1_CUCME .

Related features