Polypeptide MELO3C004448P1

Accession: MELO3C004448P1

Name: MELO3C004448P1

Description: Similar to DNA replication licensing factor mcm5-A (Xenopus laevis) (uniprot_sprot:sp|P55862|MCM5A_XENLA)

Sequence:

>MELO3C004448P1 Similar to DNA replication licensing factor mcm5-A (Xenopus laevis) (uniprot_sprot:sp|P55862|MCM5A_XENLA)
MSGWDEGGIYYSDQAQSLGDGTGIGRSGDADDKATHHSVLRKFKEFIRGFEADKNVFPYRESLLHNPKFLRVDMEDVNAF
DSDLPAKLRSAPADFLPLFETAAGEVLRNLKTKVAGETGEMVEPVPGDVQILLTSKEDPVSMRSLGAQYISKLVKISGIT
IAASRTKAKATYVTLICKNCRSTTRVPCRPGLGGAIVPRSCTHVPQPGEEPCPLDPWIVVPDKSMYVDQQTLKLQENPED
VPTGELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIYQASNSSTSHKGAVAIRQPYIRVVGIEECNETNSRGPASFTTED
IEEFKKFAAEPDVYKSICSKIAPSIFGHDDVKKAVACLLFGGSRKNLPDGVKLRGDINVLLLGDPSTAKSQFLKFVEKTA
PVAVYTSGKGSSAAGLTASVIRDSSSREFYLEGGAMVLADGGVVCIDEFDKMRSEDRVAIHEAMEQQTISIAKAGITTVL
NSRTSVLAAANPPSGRYDDLKTAQDNIDLQTTILSRFDLIFIVKDIRMYSQDKIIASHIIKVHASAGATLGENRASKEEN
WLKRYIQYCRTQCYPRLSESASTMLQNNYVKIRQDMRQQANETGEAAAIPITVRQLEAIVRLSEALAKMKLSHVATEENV
QEAIRLFTVSTMDAARSGIHQQVNLTPEIANEIKQAETQIKRRIGIGNHISERRLIDELAKMGMNESIVRRALIIMHQRD
EVEYKRERRVIFRKA*

Download fasta sequence.

Properties

These properties come from blast2go analysis

molecular_function: oxidoreductase activity, DNA-dependent ATPase activity, ATP binding, DNA binding.

cellular_component: cytoplasm, nucleus.

biological_process: DNA-dependent DNA replication initiation, DNA unwinding involved in replication.

These properties come from reactome analysis

REACTOME_REACTION: Cdc45 associates with the pre-replicative complex at the origin (REACT_31079), Mcm4,6,7 trimer forms and associates with the replication fork (REACT_32906), Mcm2-7 associates with the Cdt1:CDC6:ORC:origin complex, forming the pre-replicative complex (preRC) (REACT_106952), Multiple proteins are localized at replication fork (REACT_83344), Multiple proteins are localized at replication fork (REACT_93102), MCM2-7 mediated fork unwinding (REACT_102560), Mcm4,6,7 trimer forms and associates with the replication fork (REACT_94444), Mcm10 associates with the pre-replicative complex, stabilizing Mcm2-7 (REACT_76949), Cdc45 associates with the pre-replicative complex at the origin (REACT_108604), Mcm10 associates with the pre-replicative complex, stabilizing Mcm2-7 (REACT_98657), MCM2-7 mediated fork unwinding (REACT_85172), Mcm2-7 associates with the Cdt1:CDC6:ORC:origin complex, forming the pre-replicative complex (preRC) (REACT_32416).

biological_process: DNA strand elongation involved in DNA replication, M/G1 transition of mitotic cell cycle, mitotic cell cycle, G1/S transition of mitotic cell cycle, S phase of mitotic cell cycle.

REACTOME_PATHWAY: Synthesis of DNA (REACT_29939), DNA strand elongation (REACT_84115), DNA strand elongation (REACT_85667), Unwinding of DNA (REACT_93501), Mitotic M-M/G1 phases (REACT_82114), S Phase (REACT_82813), Removal of licensing factors from origins (REACT_90316), Activation of the pre-replicative complex (REACT_110126), Unwinding of DNA (REACT_105674), Removal of licensing factors from origins (REACT_102652), DNA Replication Pre-Initiation (REACT_99126), M/G1 Transition (REACT_32146), Cell Cycle, Mitotic (REACT_85950), Activation of the pre-replicative complex (REACT_83196), DNA Replication Pre-Initiation (REACT_88865), Mitotic M-M/G1 phases (REACT_88420), Mitotic G1-G1/S phases (REACT_82281), Switching of origins to a post-replicative state (REACT_101513), Mitotic G1-G1/S phases (REACT_109527), Switching of origins to a post-replicative state (REACT_110251), M/G1 Transition (REACT_83776), Regulation of DNA replication (REACT_109529), G1/S Transition (REACT_109784), Assembly of the pre-replicative complex (REACT_108945), Regulation of DNA replication (REACT_102039), DNA Replication (REACT_85544), DNA Replication (REACT_102375), Cell Cycle, Mitotic (REACT_90846), Assembly of the pre-replicative complex (REACT_88527), Synthesis of DNA (REACT_98237), G1/S Transition (REACT_102687), S Phase (REACT_34043).

These properties come from phylome analysis

molecular_function: ATP binding, DNA binding.

cellular_component: cytoplasm, nucleus.

biological_process: DNA-dependent DNA replication initiation, DNA unwinding involved in replication.

These properties come from kegg analysis

KEGG_ORTHOLOGS: minichromosome maintenance protein 5 (cell division control protein 46) (K02209).

KEGG_MODULE: MCM complex (M00285).

COG: Predicted ATPase involved in replication control, Cdc46/Mcm family (COG1241).

Locations

Located in CM3.5_scaffold00003 from 7294685 to 7299900.

This polypeptide in other databases

In PhylomeDB is Phy003LHMZ_CUCME .

Related features