Polypeptide MELO3C004473P2

Accession: MELO3C004473P2

Name: MELO3C004473P2

Description: Similar to Actin-related protein 2/3 complex subunit 3 (Mus musculus) (uniprot_sprot:sp|Q9JM76|ARPC3_MOUSE)

Sequence:

>MELO3C004473P2 Similar to Actin-related protein 2/3 complex subunit 3 (Mus musculus) (uniprot_sprot:sp|Q9JM76|ARPC3_MOUSE)
MVHHSSFVDEEGISKACGCPLLPLKSHIKGPAPVSDQDKTDIVDEAITFFRANVFFRNFDIKSPADKLLIYLTFYINVAL
KRLEGCRTLAVGTKAIINLGLENVPVPGESGFPFPGLFPIPQSNEEAELFRNYLKQIREETSGRLLSVAYRANGTPNKWW
LAFAKRKFMNIIIP*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_PATHWAY: Salmonella infection (ko05132), Shigellosis (ko05131), Bacterial invasion of epithelial cells (ko05100).

KEGG_ORTHOLOGS: actin related protein 2/3 complex, subunit 3 (K05756).

These properties come from phylome analysis


molecular_function: identical protein binding, structural constituent of cytoskeleton, actin binding, protein binding.

cellular_component: Arp2/3 protein complex, mitochondrion, cytoplasm, cytoskeleton.

biological_process: establishment of mitochondrion localization, meiotic chromosome segregation, negative regulation of vulval development, positive regulation of growth rate, growth, oviposition, morphogenesis of embryonic epithelium, epithelial cell migration, embryo development ending in birth or egg hatching, actin filament organization, cellular component movement, nematode larval development, mitochondrion inheritance, regulation of actin filament polymerization.

These properties come from blast2go analysis


molecular_function: protein binding.

cellular_component: cytoskeleton.

biological_process: regulation of actin filament polymerization.

Locations

Located in CM3.5_scaffold00003 from 7589954 to 7591033.

This polypeptide in other databases

In PhylomeDB is Phy003LH5W_CUCME .

Related features