Polypeptide MELO3C004476P1

Accession: MELO3C004476P1

Name: MELO3C004476P1

Description: Similar to Probable anion transporter 6, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|Q3E9A0|ANTR6_ARATH)

Sequence:

>MELO3C004476P1 Similar to Probable anion transporter 6, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|Q3E9A0|ANTR6_ARATH)
MANFSIRPHNSPFLSHPTNHPIFHSVSSTRFISHHRLLRLSLRVCCSIKEKENVKRNEDISPVLSGLRVDASERSGSVSK
SENDLSSGHENDEAGSDLNWPPWRNVPDRYKLIGTTALAFVICNMDKVNLSVAIIPMSHQFGWNSSVAGLVQSSFFWGYA
LSQLPGGWLAKIFGGRKVLEIGVLTWSLATALVPFLAGYMPGLIFSRILVGIGEGVSPSAATDLIARTIPLQERSRAVAF
VFGGLSVGSVSGLLLSPSLIQNFGWESVFYIFGFLGIAWFAGFQFLDGQPAGPLKSLLVVESESESDSVLLKKKSTTPFK
LQQLPAALKEVPWRAFLEYPPVWAMIYVHFCGSWGHYTCLSWLPTYFSEELNLNLTEAAWVSILPPLASIFVTSIASQLA
DNLISNGVDTTTVRKICQTIAFVSPAVCMTLSSVDLGLPPWEVVGILTSGLALSSFALSGLYCTHQDMSPEYASVLLQAS
L*

Download fasta sequence.

Properties

These properties come from reactome analysis

REACTOME_REACTION: L-Glutamate loading of synaptic vesicle (REACT_12503), release of L-Glutamate at the synapse (REACT_12411), Proton-coupled sialic acid co-transport (REACT_19297), Glutamate synaptic vesicle docking and priming (REACT_12617), Vesicular glutamate transport (REACT_19233), Vesicular glutamate transport (REACT_83766), Vesicular glutamate transport (REACT_108641).

biological_process: synaptic transmission, neurotransmitter secretion, glutamate secretion, ion transport, transmembrane transport.

REACTOME_COMPLEX: Empty Glutamate Synaptic Vesicle [cytosol] (REACT_14482), Docked Glutamate Loaded Synaptic Vesicle [plasma membrane] (REACT_12825), Glutamate loaded synaptic vesicle [cytosol] (REACT_12769).

REACTOME_PATHWAY: Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_91958), Transmembrane transport of small molecules (REACT_102897), Neurotransmitter Release Cycle (REACT_13723), Amino acid and oligopeptide SLC transporters (REACT_30787), Glutamate Neurotransmitter Release Cycle (REACT_12591), Synaptic Transmission (REACT_13685), Transmission across Chemical Synapses (REACT_13477), Amino acid and oligopeptide SLC transporters (REACT_28556), Organic anion transporters (REACT_100100), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_79109), SLC-mediated transmembrane transport (REACT_101577), SLC-mediated transmembrane transport (REACT_19118), Organic anion transporters (REACT_19372), Transmembrane transport of small molecules (REACT_15518), Organic anion transporters (REACT_100816), Transmembrane transport of small molecules (REACT_86409), SLC-mediated transmembrane transport (REACT_98716), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_19397), Amino acid and oligopeptide SLC transporters (REACT_19419).

These properties come from phylome analysis

molecular_function: inorganic phosphate transmembrane transporter activity.

cellular_component: chloroplast membrane, integral to membrane.

biological_process: transmembrane transport.

These properties come from blast2go analysis

cellular_component: membrane, plastid.

biological_process: transmembrane transport.

Locations

Located in CM3.5_scaffold00003 from 7606953 to 7612740.

This polypeptide in other databases

In PhylomeDB is Phy003LM16_CUCME .

Related features