Polypeptide MELO3C004594P1
Accession: MELO3C004594P1
Name: MELO3C004594P1
Description: Similar to Mitogen-activated protein kinase kinase 6 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FJV0|M2K6_ARATH)
Sequence:
>MELO3C004594P1 Similar to Mitogen-activated protein kinase kinase 6 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FJV0|M2K6_ARATH) MKMKTKTPMKQLKLSVPVQETSIRSFLTASGTFHDGNLLLNQKGLRLISEEKESQTTDSKELDVDFSLEDLETVKVIGKG SGGVVQLVRHKWVGKFFALKVIQMNIQEDIRKQIVQELKINQAAQCSHIVVCYHSFYHNGAISLVLEYMDRGSLADVVRQ VKTILEPYLAVVCKQVLQGLVYLHHERHVIHRDIKPSNLLVNHKGEVKITDFGVSAMLASSMGQRDTFVGTYNYMSPERI SGGTYDYSSDIWSLGLVVLECAIGRFPYLQSEEQQSWPSFYELLEAIVAKPPPSAPPDQFSPEFCSFVSACIKKDPKERS SSLDLLNHPFIKKFEDKDIDVGILVASLDPPVSFPRQQQQ*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_PATHWAY: MAP kinase activation in TLR cascade (REACT_32136), Toll Like Receptor 10 (TLR10) Cascade (REACT_110819), Toll Like Receptor 4 (TLR4) Cascade (REACT_91584), SOS-mediated signalling (REACT_99222), Toll Like Receptor 4 (TLR4) Cascade (REACT_79117), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_79068), MyD88 dependent cascade initiated on endosome (REACT_94468), Innate Immunity Signaling (REACT_6802), Apoptotic execution phase (REACT_995), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_25281), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_88077), MyD88-independent cascade initiated on plasma membrane (REACT_6809), Toll Like Receptor 4 (TLR4) Cascade (REACT_109895), SHC-related events (REACT_999), Activated TLR4 signalling (REACT_33197), ERK1 activation (REACT_79430), Activated TLR4 signalling (REACT_87317), L1CAM interactions (REACT_94606), Signalling to p38 via RIT and RIN (REACT_77940), Activated TLR4 signalling (REACT_6890), Signalling to ERKs (REACT_82045), Apoptotic cleavage of cellular proteins (REACT_107), MyD88:Mal cascade initiated on plasma membrane (REACT_6788), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_96313), Signaling by Insulin receptor (REACT_498), Toll Receptor Cascades (REACT_98692), Innate Immunity Signaling (REACT_108180), Signalling by NGF (REACT_82686), MAP kinase activation in TLR cascade (REACT_98311), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_6782), Toll Like Receptor 3 (TLR3) Cascade (REACT_6783), Toll Like Receptor 3 (TLR3) Cascade (REACT_96401), Insulin receptor signalling cascade (REACT_90766), Toll Like Receptor 10 (TLR10) Cascade (REACT_9027), Interleukin-1 signaling (REACT_22442), RAF/MAP kinase cascade (REACT_634), MyD88:Mal cascade initiated on plasma membrane (REACT_80624), L1CAM interactions (REACT_22205), Activated TLR4 signalling (REACT_91273), Innate Immunity Signaling (REACT_90618), ARMS-mediated activation (REACT_12002), Innate Immunity Signaling (REACT_88681), Signaling by EGFR (REACT_9417), activated TAK1 mediates p38 MAPK activation (REACT_91962), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_34578), SOS-mediated signalling (REACT_83934), JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 (REACT_21368), Shc events in EGFR signaling (REACT_12579), Frs2-mediated activation (REACT_12076), Signalling to p38 via RIT and RIN (REACT_12077), Toll Receptor Cascades (REACT_85362), Grb2 events in EGFR signaling (REACT_83336), Signaling by Insulin receptor (REACT_6313), MyD88 dependent cascade initiated on endosome (REACT_87458), MyD88 cascade initiated on plasma membrane (REACT_88909), SOS-mediated signalling (REACT_524), ARMS-mediated activation (REACT_109866), NGF signalling via TRKA from the plasma membrane (REACT_29880), MAP kinase activation in TLR cascade (REACT_85645), Activated TLR4 signalling (REACT_90914), Axon guidance (REACT_18266), Toll Like Receptor 3 (TLR3) Cascade (REACT_105689), Innate Immunity Signaling (REACT_95642), Toll Like Receptor 9 (TLR9) Cascade (REACT_107954), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_25024), Signalling to ERK5 (REACT_107061), IRS-mediated signalling (REACT_332), Toll Like Receptor 3 (TLR3) Cascade (REACT_99649), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_88341), Toll Like Receptor 4 (TLR4) Cascade (REACT_80044), MyD88 cascade initiated on plasma membrane (REACT_81183), Toll Like Receptor 10 (TLR10) Cascade (REACT_31842), MyD88-independent cascade initiated on plasma membrane (REACT_99643), Toll Like Receptor TLR1:TLR2 Cascade (REACT_89891), Toll Like Receptor 2 Cascade (REACT_109018), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_102363), Signaling by PDGF (REACT_106012), Apoptosis (REACT_100045), Signalling by NGF (REACT_97378), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_28593), IRS-related events (REACT_87578), Toll Like Receptor 4 (TLR4) Cascade (REACT_6894), ERK2 activation (REACT_81711), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_34570), Toll Like Receptor 3 (TLR3) Cascade (REACT_87070), RAF/MAP kinase cascade (REACT_85806), MEK activation (REACT_962), NOD1/2 Signaling Pathway (REACT_75776), Signal transduction by L1 (REACT_22272), Toll Like Receptor TLR1:TLR2 Cascade (REACT_101461), Toll Like Receptor TLR6:TLR2 Cascade (REACT_106314), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_78006), Toll Like Receptor TLR1:TLR2 Cascade (REACT_8005), Down-stream signal transduction (REACT_88006), Toll Like Receptor TLR6:TLR2 Cascade (REACT_8006), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_96421), Signalling to ERKs (REACT_32318), Immune System (REACT_105951), Signalling by NGF (REACT_90112), Toll Like Receptor 2 Cascade (REACT_32312), Cytokine Signaling in Immune system (REACT_75790), JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 (REACT_32253), Signalling to ERK5 (REACT_12020), L1CAM interactions (REACT_89546), Toll Like Receptor TLR1:TLR2 Cascade (REACT_91838), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_106858), Frs2-mediated activation (REACT_85533), NGF signalling via TRKA from the plasma membrane (REACT_107118), SHC-mediated signalling (REACT_81076), Signal transduction by L1 (REACT_94201), Down-stream signal transduction (REACT_79504), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_85088), Grb2 events in EGFR signaling (REACT_33317), MyD88 dependent cascade initiated on endosome (REACT_29524), Signaling by EGFR (REACT_89544), MyD88 cascade initiated on plasma membrane (REACT_104035), SHC-mediated signalling (REACT_78477), ERK1 activation (REACT_30605), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_33857), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_79305), Toll Like Receptor 10 (TLR10) Cascade (REACT_82644), Toll Like Receptor 3 (TLR3) Cascade (REACT_34013), Insulin receptor signalling cascade (REACT_1195), Toll Like Receptor 9 (TLR9) Cascade (REACT_93905), Signalling by NGF (REACT_11061), Toll Like Receptor 2 Cascade (REACT_7980), Toll Like Receptor 5 (TLR5) Cascade (REACT_78753), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_97258), Toll Like Receptor 5 (TLR5) Cascade (REACT_30810), IRS-mediated signalling (REACT_97132), MyD88 cascade initiated on plasma membrane (REACT_93873), Immune System (REACT_84034), Toll Like Receptor 9 (TLR9) Cascade (REACT_32391), Signalling to RAS (REACT_79426), Signalling to RAS (REACT_12033), Toll Like Receptor 9 (TLR9) Cascade (REACT_103126), Toll Like Receptor TLR1:TLR2 Cascade (REACT_91544), MyD88 cascade initiated on plasma membrane (REACT_96209), Toll Like Receptor TLR6:TLR2 Cascade (REACT_103395), Prolonged ERK activation events (REACT_91625), Toll Like Receptor 5 (TLR5) Cascade (REACT_82163), Immune System (REACT_97310), Signaling by PDGF (REACT_109659), MyD88-independent cascade initiated on plasma membrane (REACT_78892), MyD88:Mal cascade initiated on plasma membrane (REACT_86913), Immune System (REACT_6900), Innate Immunity Signaling (REACT_81815), activated TAK1 mediates p38 MAPK activation (REACT_87442), MyD88 cascade initiated on plasma membrane (REACT_27215), NGF signalling via TRKA from the plasma membrane (REACT_102976), RAF phosphorylates MEK (REACT_614), Toll Like Receptor 2 Cascade (REACT_92918), ERK2 activation (REACT_1183), Signalling to RAS (REACT_81747), IRS-related events (REACT_104222), MAP kinase activation in TLR cascade (REACT_34622), Toll Receptor Cascades (REACT_91529), MyD88 dependent cascade initiated on endosome (REACT_88704), Toll Receptor Cascades (REACT_85453), NGF signalling via TRKA from the plasma membrane (REACT_100895), Signaling by PDGF (REACT_16888), RAF/MAP kinase cascade (REACT_92987), SHC-related events (REACT_92272), Shc events in EGFR signaling (REACT_80014), IRS-mediated signalling (REACT_81492), Activated TLR4 signalling (REACT_78833), Toll Receptor Cascades (REACT_6966), Grb2 events in EGFR signaling (REACT_12606), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_95028), Signal transduction by L1 (REACT_89899), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_102886), Frs2-mediated activation (REACT_110941), IRS-related events (REACT_762), Interleukin-2 signaling (REACT_27283), MyD88-independent cascade initiated on plasma membrane (REACT_28410), Signalling to p38 via RIT and RIN (REACT_42108), Toll Like Receptor 5 (TLR5) Cascade (REACT_9061), Toll Like Receptor 5 (TLR5) Cascade (REACT_77972), Axon guidance (REACT_29862), MyD88-independent cascade initiated on plasma membrane (REACT_102299), Toll Like Receptor 2 Cascade (REACT_94528), activated TAK1 mediates p38 MAPK activation (REACT_102813), Signaling by Interleukins (REACT_22232), activated TAK1 mediates p38 MAPK activation (REACT_96987), Toll Like Receptor 10 (TLR10) Cascade (REACT_102819), Toll Like Receptor 10 (TLR10) Cascade (REACT_92313), Signaling by Insulin receptor (REACT_78672), Signalling to ERKs (REACT_12058), MyD88:Mal cascade initiated on plasma membrane (REACT_85347), NGF signalling via TRKA from the plasma membrane (REACT_12056), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_9020), ERK2 activation (REACT_90463), ARMS-mediated activation (REACT_84489), MyD88-independent cascade initiated on plasma membrane (REACT_85813), Toll Like Receptor 5 (TLR5) Cascade (REACT_77312), Shc events in EGFR signaling (REACT_77142), MyD88 dependent cascade initiated on endosome (REACT_103436), ERK activation (REACT_101978), Immune System (REACT_81385), Apoptosis (REACT_578), Prolonged ERK activation events (REACT_33773), Toll Like Receptor TLR1:TLR2 Cascade (REACT_34248), ERK1 activation (REACT_1391), Toll Like Receptor 2 Cascade (REACT_29705), NCAM signaling for neurite out-growth (REACT_78289), activated TAK1 mediates p38 MAPK activation (REACT_21399), Toll Like Receptor TLR6:TLR2 Cascade (REACT_106218), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_85188), MyD88 dependent cascade initiated on endosome (REACT_25222), Toll Like Receptor TLR6:TLR2 Cascade (REACT_79076), NCAM signaling for neurite out-growth (REACT_18334), SHC-related events (REACT_85436), Toll Like Receptor TLR6:TLR2 Cascade (REACT_88205), MyD88:Mal cascade initiated on plasma membrane (REACT_92018), MyD88:Mal cascade initiated on plasma membrane (REACT_99530), Signaling by EGFR (REACT_89866), Toll Like Receptor 9 (TLR9) Cascade (REACT_9047), MAP kinase activation in TLR cascade (REACT_21308), Down-stream signal transduction (REACT_17025), Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways (REACT_75913), Immune System (REACT_78489), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_97163), Toll Like Receptor 9 (TLR9) Cascade (REACT_104873), Axon guidance (REACT_110262), MAP kinase activation in TLR cascade (REACT_82500), Apoptotic execution phase (REACT_81021), ERK activation (REACT_1482), Signalling by NGF (REACT_82110), NCAM signaling for neurite out-growth (REACT_87288), Toll Like Receptor 4 (TLR4) Cascade (REACT_84510), SHC-mediated signalling (REACT_661), Insulin receptor signalling cascade (REACT_30635), Prolonged ERK activation events (REACT_12005), Signalling to ERK5 (REACT_31272), ERK activation (REACT_80936), Toll Receptor Cascades (REACT_92498), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_30390).
REACTOME_REACTION: activated human TAK1 phosphorylates MKK3/MKK6 (REACT_21338), MEK1 binds ERK-1 (REACT_86136), Activation of p38 MAPK (REACT_75807), activated human MKK3/MKK6 phosphorylates p38 MAPK complexed with MAPKAPK2 or MAPKAPK3 (REACT_95515), Dissociation of phospho-ERK-2:MEK2 (REACT_1019), MEK2 phosphorylates ERK-2 (REACT_2247), RAF1 phosphorylates MEK2 (REACT_1727), Dissociation of phospho-ERK-1:MEK1 (REACT_1740), MEK1 binds ERK-1 (REACT_90149), Inactivation of MEK1 by p34cdc2 (REACT_101930), Phosphorylation of human JNKs by activated MKK4/MKK7 (REACT_6896), ERK5 is activated (REACT_100829), Inactivation of MEK1 by p34cdc2 (REACT_1836), activated human MKK3/MKK6 phosphorylates p38 MAPK complexed with MAPKAPK2 or MAPKAPK3 (REACT_21395), Caspase-mediated cleavage of MASK (REACT_13636), Activated RAF1 complex binds MEK (REACT_143), TPL2 phosphorylates MEK1, SEK1 (REACT_22271), MEK1 phosphorylates ERK-1 (REACT_79487), MEK2 binds ERK-2 (REACT_495), phosphorylated MKK3/MKK6 migrates to nucleus (REACT_21299), phosphorylated MKK3/MKK6 migrates to nucleus (REACT_89135), phosphorylated MKK3/MKK6 migrates to nucleus (REACT_95697), Inactivation of MEK1 by p34cdc2 (REACT_101920), phosphorylated MKK3/MKK6 migrates to nucleus (REACT_107070), TAK1 phosphorylates MKK6 (REACT_22190), Activated TAK1 phosphorylates MKK4/MKK7 (REACT_21367), Nuclear translocation of catalytic domain of Mst3 (REACT_103110), MEK1 binds ERK-1 (REACT_1780), Dissociation of phospho-ERK-1:MEK1 (REACT_90859), activated human MKK3/MKK6 phosphorylates p38 MAPK complexed with MAPKAPK2 or MAPKAPK3 (REACT_91195), ERK5 is activated (REACT_104581), ERK5 is activated (REACT_12075), phosphorylated MKK3/MKK6 migrates to nucleus (REACT_77096), Dissociation of phospho-ERK-1:MEK1 (REACT_81846), MEK1 phosphorylates ERK-1 (REACT_136), Phosphorylation of human JNKs by activated MKK4/MKK7 (REACT_81103), MEK1 phosphorylates ERK-1 (REACT_110554), RAF1 phosphorylates MEK1 (REACT_545).
REACTOME_COMPLEX: phospho-ERK-1:MEK1 [cytosol] (REACT_2796), MEK1:ERK-1 [cytosol] (REACT_5539), MKK3-P:MKK6-P [cytosol] (REACT_21595), MKK3-P:MKK6-P [nucleoplasm] (REACT_21457), Activated RAF1 complex:MEK [plasma membrane] (REACT_3953), phospho-ERK-2:MEK2 [cytosol] (REACT_3199), Activated RAF1 complex:MEK2 [plasma membrane] (REACT_4223), Activated RAF1 complex:MEK1 [plasma membrane] (REACT_4256), MEK2:ERK-2 [cytosol] (REACT_5435), MKK3:MKK6 [cytosol] (REACT_21767).
biological_process: Toll signaling pathway, MAPKKK cascade, epidermal growth factor receptor signaling pathway, nucleotide-binding oligomerization domain containing signaling pathway, cellular component disassembly involved in apoptosis, toll-like receptor 4 signaling pathway, nerve growth factor receptor signaling pathway, MyD88-dependent toll-like receptor signaling pathway, MyD88-independent toll-like receptor signaling pathway, activation of innate immune response, axon guidance, JNK cascade, small GTPase mediated signal transduction, toll-like receptor signaling pathway, insulin receptor signaling pathway, ERK1 and ERK2 cascade, activation of MAPK activity, activation of MAPKK activity, toll-like receptor 3 signaling pathway, toll-like receptor 2 signaling pathway, toll-like receptor 1 signaling pathway, innate immune response, apoptosis, stress-activated MAPK cascade, Ras protein signal transduction.
These properties come from phylome analysis
molecular_function: protein serine/threonine kinase activity, protein binding, ATP binding, MAP kinase kinase activity.
biological_process: protein phosphorylation.
These properties come from blast2go analysis
molecular_function: protein serine/threonine kinase activity, protein binding, ATP binding.
biological_process: protein phosphorylation.
This polypeptide in other databases
In PhylomeDB is Phy003A9PT_CUCME .

