Polypeptide MELO3C004612P1
Accession: MELO3C004612P1
Name: MELO3C004612P1
Description: Similar to 40S ribosomal protein S30 (Arabidopsis thaliana) (uniprot_sprot:sp|P49689|RS30_ARATH)
Sequence:
>MELO3C004612P1 Similar to 40S ribosomal protein S30 (Arabidopsis thaliana) (uniprot_sprot:sp|P49689|RS30_ARATH) MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK*
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_ORTHOLOGS: small subunit ribosomal protein S30e (K02983).
cellular_component: cytosolic small ribosomal subunit.
These properties come from phylome analysis
molecular_function: structural constituent of ribosome.
cellular_component: ribosome.
biological_process: translation.
These properties come from blast2go analysis
molecular_function: structural constituent of ribosome.
cellular_component: cytosolic small ribosomal subunit, mitochondrion.
biological_process: translation.
This polypeptide in other databases
In PhylomeDB is Phy003AA6P_CUCME .

