Polypeptide MELO3C004761P2
Accession: MELO3C004761P2
Name: MELO3C004761P2
Description: Similar to CBS domain-containing protein CBSX1, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|O23193|CBSX1_ARATH)
Sequence:
>MELO3C004761P2 Similar to CBS domain-containing protein CBSX1, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|O23193|CBSX1_ARATH) MESIVCSLSSLSLAHLRAKSFSVQEMLFGPCRRLSLPILHASVAQSFPELRKSTSLAASGTLMANSVPSGTGVYTVGDFM TRKEELHVVKPTTSVDEALEILVEKRITGFPVIDDNWKLVGVVSDYDLLALDSISGGGRTDTSMFPEVDSSWKTFNEVQR LLSKTNGKVVGDLMTTAPLVVREITDLEDVARLLLQTKYRRLPVVDADGKLVGIITRGNVVRAALQIKHAEENRK*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Phosphorylated AMPK binds AMP (REACT_81047), AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_627), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_11110), AMPK is dephosphorylated (REACT_109701), Activation of cytosolic AMPK by phosphorylation (REACT_31513), Phosphorylated AMPK phosphorylates TSC2 (REACT_21348), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_79108), Phosphorylated AMPK binds AMP (REACT_21293), Phosphorylation of ChREBP at Serine 568 by AMPK (REACT_349), LKB1 phosphorylates the alpha subunit of AMPK heterotrimer (REACT_96873), AMPK is dephosphorylated (REACT_21418), AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_34086), LKB1 phosphorylates the alpha subunit of AMPK heterotrimer (REACT_1325), Phosphorylation of ChREBP at Serine 568 by AMPK (REACT_101245), AMPK phosphorylates Raptor (REACT_21413), Activation of cytosolic AMPK by phosphorylation (REACT_11183).
biological_process: regulation of fatty acid biosynthetic process, cellular lipid metabolic process, cell cycle arrest, carnitine shuttle, insulin receptor signaling pathway, energy reserve metabolic process, regulation of fatty acid oxidation.
REACTOME_COMPLEX: Phosphorylated AMPK heterotrimer [cytosol] (REACT_17720), AMPK heterotrimer:AMP [nucleoplasm] (REACT_4802), AMPK heterotrimer (inactive) [nucleoplasm] (REACT_3733), AMPK heterotrimer [cytosol] (REACT_18135), Phosphorylated AMPK heterotrimer:AMP [cytosol] (REACT_21851), AMPK heterotrimer (active) [cytosol] (REACT_11854), Activated AMPK heterotrimer [nucleoplasm] (REACT_5306), AMPK gamma2:AMP [nucleoplasm] (REACT_4963).
REACTOME_PATHWAY: Energy dependent regulation of mTOR by LKB1-AMPK (REACT_21387), PI3K Cascade (REACT_976), Integration of energy metabolism (REACT_31409), Regulation of AMPK activity via LKB1 (REACT_21285), IRS-related events (REACT_762), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_30569), PI3K Cascade (REACT_81331), IRS-mediated signalling (REACT_97132), Insulin receptor signalling cascade (REACT_90766), mTOR signalling (REACT_6838), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_31891), Signaling by Insulin receptor (REACT_498), Metabolism of lipids and lipoproteins (REACT_104203), AMPK inhibits chREBP transcriptional activation activity (REACT_102284), Regulation of Rheb GTPase activity by AMPK (REACT_21393), Energy dependent regulation of mTOR by LKB1-AMPK (REACT_78416), Metabolism of lipids and lipoproteins (REACT_22258), AMPK inhibits chREBP transcriptional activation activity (REACT_1988), mTOR signalling (REACT_101313), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_22279), IRS-related events (REACT_87578), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_11082), PKB-mediated events (REACT_456), Integration of energy metabolism (REACT_1505), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_101666), Regulation of AMPK activity via LKB1 (REACT_86986), Signaling by Insulin receptor (REACT_78672), IRS-mediated signalling (REACT_332), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_11163), Insulin receptor signalling cascade (REACT_1195), PKB-mediated events (REACT_87031).
These properties come from phylome analysis
molecular_function: catalytic activity.
cellular_component: chloroplast.
These properties come from blast2go analysis
molecular_function: catalytic activity.
cellular_component: chloroplast stroma.
biological_process: metabolic process.
This polypeptide in other databases
In PhylomeDB is Phy003A488_CUCME .
