Polypeptide MELO3C004854P1
Accession: MELO3C004854P1
Name: MELO3C004854P1
Description: Similar to 50S ribosomal protein L14, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q8WKP4|RK14_CUCSA)
Sequence:
>MELO3C004854P1 Similar to 50S ribosomal protein L14, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q8WKP4|RK14_CUCSA) MIQPQTLLNVADNSGARELMCIRIIGASNRRYAHIGDIIVVVIKKAVPNTPLEMTLTQ*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: rRNA binding, structural constituent of ribosome.
cellular_component: large ribosomal subunit, chloroplast.
biological_process: translation.
This polypeptide in other databases
In PhylomeDB is Phy003MDI0_CUCME .
